EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00261 - Tropomyosin)
FAM  PF00261
PID  Tropomyosin
DES  Tropomyosin
IPR  IPR000533
ANO  8
ALN  237
AID  0.657538
APH  ((TPM2_CHICK/48-284:0.08163,(TPM4_RAT/11-247:0.27516,((TPM2_DROME/48-284:0.39982,TPM1_DROME/48-284:0.19105):0.05762,TPMM_TRICO/48-284:0.14259):0.42656):0.07564):0.03720,(TPM1_CHICK/48-284:0.01047,TPM1_HUMAN/48-284:0.03247):0.02993,TPM3_MOUSE/48-284:0.02349);
ATP  ((TPM2_CHICK/48-284,(TPM4_RAT/11-247,((TPM2_DROME/48-284,TPM1_DROME/48-284),TPMM_TRICO/48-284))),(TPM1_CHICK/48-284,TPM1_HUMAN/48-284),TPM3_MOUSE/48-284);
ATL  1.78363
DNO  8
DLN  711
DID  0.649437
DPH  ((TPM3_MOUSE/48-284:0.11511,(TPM2_CHICK/48-284:0.11771,(TPM4_RAT/11-247:0.23483,(TPM2_DROME/48-284:0.27253,(TPM1_DROME/48-284:0.16138,TPMM_TRICO/48-284:0.26478):0.06162):0.25168):0.08237):0.02895):0.05685,TPM1_HUMAN/48-284:0.08311,TPM1_CHICK/48-284:0.06893);
DTP  ((TPM3_MOUSE/48-284,(TPM2_CHICK/48-284,(TPM4_RAT/11-247,(TPM2_DROME/48-284,(TPM1_DROME/48-284,TPMM_TRICO/48-284))))),TPM1_HUMAN/48-284,TPM1_CHICK/48-284);
DTL  1.79986
RID  0.657538
RPH  ((TPM2_CHICK/48-284:0.08163,(TPM4_RAT/11-247:0.27516,((TPM2_DROME/48-284:0.39982,TPM1_DROME/48-284:0.19105):0.05762,TPMM_TRICO/48-284:0.14259):0.42656):0.07564):0.03720,(TPM1_CHICK/48-284:0.01047,TPM1_HUMAN/48-284:0.03247):0.02993,TPM3_MOUSE/48-284:0.02349);
RTP  ((TPM2_CHICK/48-284,(TPM4_RAT/11-247,((TPM2_DROME/48-284,TPM1_DROME/48-284),TPMM_TRICO/48-284))),(TPM1_CHICK/48-284,TPM1_HUMAN/48-284),TPM3_MOUSE/48-284);
RTL  1.78363
LNK  TPM1_CHICK/48-284:P04268:X57991
LNK  TPM1_DROME/48-284:P06754:M15466
LNK  TPM1_HUMAN/48-284:P09493:M19713
LNK  TPM2_CHICK/48-284:P19352:M21226
LNK  TPM2_DROME/48-284:P09491:K03277
LNK  TPM3_MOUSE/48-284:P21107:AF317223
LNK  TPM4_RAT/11-247:P09495:J02780
LNK  TPMM_TRICO/48-284:P15846:J04669
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TPMM_TRICO/48-284
ASQ  KKMMQTENDLDKAQEDLAAATSQLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKIATEKLEEATHNVDESERVRKVMENGSFQDEERANTIEAQLKEAQMLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTISSRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKAISEELDSTFQELSGY
DSQ  AAGAAAATGATGCAAACAGAAAACGATTTGGACAAGGCTCAGGAAGATTTGGCTGCAGCCACCAGCCAGTTGGAAGAGAAAGAGAAGAAAGTGCAAGAGGCTGAGGCAGAGGTAGCTGCCCTGAACCGTCGCATGACTCTTCTCGAAGAAGAGCTTGAACGTGCTGAAGAACGTTTGAAGATCGCCACTGAAAAACTCGAAGAGGCCACTCACAATGTCGACGAGTCCGAGCGTGTACGCAAAGTGATGGAGAACGGCTCATTCCAAGATGAGGAGCGTGCCAACACGATTGAAGCTCAACTGAAGGAAGCCCAGATGCTTGCAGAGGAAGCCGACCGAAAATACGATGAGGTCGCCCGTAAATTGGCCATGGTTGAAGCTGATCTTGAAAGGGCCGAAGAACGTGCTGAAGCCGGAGAGAACAAGATCGTCGAATTGGAAGAGGAATTGCGTGTCGTCGGAAATAACCTGAAATCACTCGAAGTGTCCGAAGAAAAGGCACTGCAACGTGAGGACTCATACGAAGAGCAGATTCGTACCATTTCATCTCGTCTGAAGGAGGCGGAAACCCGTGCTGAATTCGCCGAGCGCTCCGTGCAGAAGCTCCAGAAGGAAGTCGACAGACTCGAGGATGAATTGGTACATGAGAAGGAGAGATACAAGGCGATTTCCGAGGAGCTTGACTCGACCTTCCAAGAACTCTCCGGCTAT
TRN  10010101100011001
NAM  TPM1_DROME/48-284
ASQ  KKIQTVENELDQTQEALTLVTGKLEEKNKALQNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKSNQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVELILK
DSQ  AAGAAGATCCAGACCGTTGAGAACGAGCTGGATCAGACCCAGGAAGCCCTGACCCTGGTCACCGGCAAGCTGGAGGAGAAGAACAAGGCTCTGCAGAACGCCGAATCCGAGGTTGCCGCTCTGAACCGTCGCATCCAGTTGCTCGAAGAAGACTTGGAGCGCTCTGAGGAGCGTCTGGGCTCCGCCACAGCCAAGCTGTCGGAAGCCTCTCAGGCCGCCGATGAGAGCGAACGTGCTCGCAAAATTCTTGAGAACCGCGCCCTTGCCGATGAAGAACGCATGGACGCTCTCGAGAATCAGCTGAAGGAAGCGCGTTTCCTTGCTGAGGAGGCTGACAAGAAATACGATGAGGTTGCCCGTAAATTGGCCATGGTTGAAGCCGATTTGGAACGTGCCGAAGAGCGTGCCGAGCAGGGTGAAAACAAAATTGTGGAGCTTGAGGAGGAGCTGCGCGTGGTTGGCAACAACCTGAAGTCCCTGGAAGTCTCTGAGGAGAAGTCCAACCAACGTGAGGAGGAGTACAAGAACCAGATCAAGACCCTCAACACCCGTCTAAAGGAGGCTGAGGCTCGTGCTGAGTTCGCTGAACGCTCCGTTCAGAAATTGCAGAAGGAAGTCGACAGGCTCGAAGACGACCTCGTCCTGGAGAAGGAGCGCTACAAGGACATCGGAGACGATCTCGACACCGCCTTCGTCGAGCTCATCCTCAAG
TRN  10010101100011011
NAM  TPM2_DROME/48-284
ASQ  KKFVQVEIDLVTAKEQLEKANTELEEKEKLLTATESEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEATQSADENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAEDRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAEHAEKQVKRLQKEVDRLEDRLFNEKEKYKAICDDLDQTFAELTGY
DSQ  AAGAAGTTCGTCCAGGTGGAGATCGATCTGGTTACCGCCAAGGAGCAGCTGGAGAAGGCCAACACCGAGCTGGAGGAGAAGGAGAAACTCCTGACCGCCACCGAGTCCGAGGTGGCCACCCAGAACCGCAAGGTGCAACAGATTGAGGAGGATCTGGAGAAGTCCGAGGAGCGCTCGACCACCGCCCAACAGAAGCTGCTGGAGGCCACCCAGTCGGCCGATGAGAACAACCGCATGTGCAAGGTGCTGGAGAACCGTTCCCAGCAGGATGAGGAGCGCATGGACCAGCTGACCAACCAGCTGAAGGAGGCCCGTATGCTGGCTGAGGATGCCGATACCAAGTCCGACGAGGTCTCCCGCAAGCTGGCCTTCGTTGAAGACGAGCTGGAGGTGGCTGAGGATCGTGTCCGCTCCGGCGAGTCCAAGATCATGGAGCTGGAGGAGGAGCTGAAGGTTGTCGGCAACTCCCTGAAGTCCCTGGAGGTGTCCGAGGAGAAGGCCAACCAGCGCGTGGAGGAGTTCAAGCGCGAGATGAAGACCCTGTCCATCAAGTTGAAGGAGGCCGAGCAGCGCGCCGAGCACGCCGAGAAGCAAGTGAAGCGCCTGCAGAAGGAGGTCGACAGGCTAGAGGACCGTCTCTTCAATGAGAAGGAAAAATACAAAGCAATCTGCGACGATTTGGACCAGACATTTGCCGAACTTACTGGATAT
TRN  10010101100011011
NAM  TPM1_HUMAN/48-284
ASQ  KKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
DSQ  AAGAAACTCAAGGGCACCGAAGATGAACTGGACAAATACTCTGAGGCTCTCAAAGATGCCCAGGAGAAGCTGGAGCTGGCAGAGAAAAAGGCCACCGATGCTGAAGCCGACGTAGCTTCTCTGAACAGACGCATCCAGCTGGTTGAGGAAGAGTTGGATCGTGCCCAGGAGCGTCTGGCAACAGCTTTGCAGAAGCTGGAGGAAGCTGAGAAGGCAGCAGATGAGAGTGAGAGAGGCATGAAAGTCATTGAGAGTCGAGCCCAAAAAGATGAAGAAAAAATGGAAATTCAGGAGATCCAACTGAAAGAGGCCAAGCACATTGCTGAAGATGCCGACCGCAAATACGAAGAGGTGGCCCGTAAGCTGGTCATCATTGAGAGCGACCTGGAACGTGCAGAGGAGCGGGCTGAGCTCTCAGAAGGCAAATGTGCCGAGCTTGAAGAAGAATTGAAAACTGTGACGAACAACTTGAAGTCACTGGAGGCTCAGGCTGAGAAGTACTCGCAGAAGGAAGACAGATATGAGGAAGAGATCAAGGTCCTTTCCGACAAGCTGAAGGAGGCTGAGACTCGGGCTGAGTTTGCGGAGAGGTCAGTAACTAAATTGGAGAAAAGCATTGATGACTTAGAAGACGAGCTGTACGCTCAGAAACTGAAGTACAAAGCCATCAGCGAGGAGCTGGACCACGCTCTCAACGATATGACTTCCATA
TRN  10010101100011000
NAM  TPM1_CHICK/48-284
ASQ  KKLKGTEDELDKYSESLKDAQEKLELADKKATDAESEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAQKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAEERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
DSQ  AAGAAGCTGAAGGGCACTGAGGATGAGCTGGACAAATACTCCGAGTCCCTTAAAGATGCACAGGAAAAGTTGGAACTGGCTGACAAAAAGGCCACAGATGCTGAGAGTGAAGTAGCTTCCCTGAACAGACGCATCCAACTGGTTGAGGAAGAGTTGGATCGGGCTCAGGAGCGCTTGGCTACTGCCCTGCAGAAGCTGGAGGAGGCTGAGAAGGCTGCAGATGAGAGTGAAAGGGGAATGAAGGTCATTGAAAATAGAGCCCAGAAGGATGAAGAGAAGATGGAAATCCAAGAGATCCAGCTTAAAGAAGCTAAGCACATTGCTGAAGAGGCTGACCGCAAGTATGAAGAGGTGGCTCGTAAGCTCGTGATCATTGAGGGTGACCTGGAGCGGGCTGAGGAGCGTGCTGAACTATCAGAAAGCAAATGTGCTGAGCTTGAAGAGGAGTTGAAAACTGTGACCAACAACCTGAAGTCGCTGGAGGCTCAGGCTGAGAAGTACTCGCAGAAAGAAGACAAATATGAAGAGGAGATTAAAGTTCTAACTGACAAACTGAAGGAGGCTGAGACCCGTGCTGAATTTGCTGAGAGGTCAGTAACCAAGCTGGAGAAGAGCATTGATGATCTAGAAGATGAGCTTTATGCTCAGAAACTGAAGTACAAAGCCATCAGCGAGGAGCTGGACCATGCTCTCAACGATATGACTTCCATA
TRN  10010101100011001
NAM  TPM3_MOUSE/48-284
ASQ  KKLKGTEDELDKYSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISDELDHALNDMTSI
DSQ  AAGAAGCTGAAAGGGACAGAGGATGAGCTGGACAAGTATTCGGAAGCTTTAAAGGATGCTCAGGAGAAGCTGGAGCTAGCAGAGAAGAAGGCAGCCGACGCTGAAGCTGAGGTGGCCTCCTTGAACCGCAGGATCCAGCTGGTTGAAGAGGAGCTGGACCGTGCGCAGGAGCGCCTTGCCACTGCTTTGCAGAAGCTGGAGGAAGCAGAGAAGGCTGCTGATGAGAGTGAGAGAGGTATGAAGGTGATTGAAAATCGGGCTCTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATCCAGCTAAAGGAAGCAAAGCACATTGCAGAAGAGGCCGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATTATTGAAGGAGACTTGGAACGCACGGAGGAACGTGCTGAGCTGGCAGAGTCTAAGTGTTCTGAGCTGGAGGAAGAGCTGAAGAATGTCACCAACAACCTCAAGTCTCTTGAGGCTCAGGCGGAGAAGTACTCTCAAAAAGAAGACAAGTATGAAGAAGAAATAAAGATTCTTACTGATAAACTCAAGGAGGCAGAGACCCGTGCTGAGTTTGCTGAAAGATCGGTAGCCAAGCTGGAGAAGACCATTGATGACCTGGAAGACGAGCTCTATGCCCAGAAACTGAAGTACAAGGCCATTAGCGACGAGCTGGACCACGCCCTCAATGACATGACCTCTATA
TRN  10010101100011010
NAM  TPM2_CHICK/48-284
ASQ  KKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEEADRKYEEVARKLVVLEGELERSEERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYEEEIKLLGEKLKEAETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
DSQ  AAGAAGCTGAAGGGCACAGAAGATGAGGTGGAGAAGTACTCTGAATCCGTCAAGGAGGCCCAGGAGAAGCTGGAGCAGGCGGAGAAGAAAGCCACGGACGCCGAGGCCGAGGTGGCTTCTCTGAACCGCCGCATCCAGCTGGTGGAGGAGGAGCTGGACCGGGCCCAGGAGCGCCTGGCCACCGCCCTGCAGAAGCTGGAAGAGGCTGAGAAGGCGGCGGATGAGAGCGAGAGAGGCATGAAGGTCATTGAGAACAGGGCCATGAAGGATGAGGAGAAAATGGAACTCCAGGAAATGCAACTGAAGGAGGCCAAACACATAGCGGAAGAGGCCGACCGCAAATATGAGGAGGTGGCCCGCAAGCTGGTGGTCCTTGAGGGAGAGCTGGAGCGCTCAGAGGAGCGAGCAGAGGTGGCGGAGAGTAAATGTGGTGACCTAGAGGAGGAGCTGAAAATTGTCACCAACAACTTGAAGTCTCTGGAGGCCCAGGCTGACAAGTATTCCACCAAGGAGGACAAGTACGAGGAGGAAATCAAGCTTCTAGGGGAGAAACTGAAGGAGGCTGAGACCAGGGCAGAGTTTGCTGAGCGGTCTGTGGCAAAGCTGGAGAAAACCATTGATGACTTAGAAGACGAAGTGTATGCACAGAAGATGAAGTACAAAGCCATCAGCGAGGAGCTGGACAATGCGCTTAACGACATCACCTCCCTC
TRN  10010101100011000
NAM  TPM4_RAT/11-247
ASQ  RKIQALQQQADDAEDRAQGLQRELDGERERREKAEGDAAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKSSDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVSKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI
DSQ  CGCAAGATCCAGGCCCTGCAGCAGCAGGCGGACGACGCAGAGGACCGTGCGCAGGGCCTGCAGCGCGAGCTGGATGGCGAGCGCGAACGGCGCGAGAAAGCTGAAGGAGATGCGGCCGCTCTCAACCGTCGCATCCAGCTGGTGGAGGAAGAGCTGGACCGGGCTCAGGAGCGACTGGCCACAGCCCTGCAGAAGCTGGAGGAGGCAGAGAAGGCTGCTGACGAGAGTGAGAGAGGCATGAAGGTGATAGAGAACCGAGCCATGAAAGACGAGGAGAAGATGGAGATCCAGGAGATGCAGCTCAAAGAAGCCAAGCACATCGCTGAGGAGGCTGACCGGAAGTATGAGGAGGTTGCTCGTAAGTTGGTCATCCTGGAGGGTGAGCTGGAGAGAGCAGAGGAGCGGGCGGAGGTGTCTGAACTAAAGAGTAGCGACCTGGAAGAGGAGCTCAAGAACGTAACTAACAATCTGAAATCACTGGAGGCTGCTTCTGAAAAGTACTCTGAAAAGGAGGATAAATATGAAGAAGAAATCAAGCTTCTGTCTGACAAACTGAAAGAGGCTGAGACCCGAGCTGAGTTTGCGGAAAGGACAGTTTCTAAACTGGAGAAGACAATCGATGACCTGGAAGAAAAACTTGCCCAGGCCAAAGAAGAGAACGTGGGCTTGCATCAGACACTGGACCAGACACTAAACGAACTTAACTGTATA
TRN  10010101100011001
//