EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00236 - Hormone_6)
FAM  PF00236
PID  Hormone_6
DES  Glycoprotein hormone
IPR  IPR000476
ANO  10
ALN  97
AID  0.686608
APH  ((((GLHA_ANGAN/25-117:0.17669,GLHA_ACALA/24-117:0.35913):0.02231,GLHA1_CYPCA/24-118:0.16659):0.00000,(((GLHA_HORSE/25-120:0.14556,(GLHA_HUMAN/25-116:0.15359,GLHA_MACMU/25-120:0.07140):0.06823):0.05380,GLHA1_RAT/25-120:0.08573):0.06549,GLHA_RANCA/1-97:0.24534):0.13358):0.10137,GLHA1_ONCKE/14-108:0.14014,GLHA2_ONCTS/23-114:0.14667);
ATP  ((((GLHA_ANGAN/25-117,GLHA_ACALA/24-117),GLHA1_CYPCA/24-118),(((GLHA_HORSE/25-120,(GLHA_HUMAN/25-116,GLHA_MACMU/25-120)),GLHA1_RAT/25-120),GLHA_RANCA/1-97)),GLHA1_ONCKE/14-108,GLHA2_ONCTS/23-114);
ATL  2.15329
DNO  8
DLN  291
DID  0.690688
DPH  ((((GLHA1_CYPCA/24-118:0.19621,GLHA_ANGAN/25-117:0.17513):0.04342,((GLHA_HORSE/25-120:0.10410,GLHA_HUMAN/25-116:0.15478):0.03295,GLHA1_RAT/25-120:0.09264):0.19710):0.02665,GLHA_ACALA/24-117:0.27600):0.08376,GLHA1_ONCKE/14-108:0.08515,GLHA2_ONCTS/23-114:0.10642);
DTP  ((((GLHA1_CYPCA/24-118,GLHA_ANGAN/25-117),((GLHA_HORSE/25-120,GLHA_HUMAN/25-116),GLHA1_RAT/25-120)),GLHA_ACALA/24-117),GLHA1_ONCKE/14-108,GLHA2_ONCTS/23-114);
DTL  1.57431
RID  0.691487
RPH  (((((GLHA1_CYPCA/24-118:0.16544,GLHA_ANGAN/25-117:0.20165):0.00000,(GLHA1_ONCKE/14-108:0.13242,GLHA2_ONCTS/23-114:0.15318):0.09518):0.04683,GLHA_ACALA/24-117:0.33553):0.10328,GLHA_HUMAN/25-116:0.19928):0.03948,GLHA_HORSE/25-120:0.20448,GLHA1_RAT/25-120:0.07288);
RTP  (((((GLHA1_CYPCA/24-118,GLHA_ANGAN/25-117),(GLHA1_ONCKE/14-108,GLHA2_ONCTS/23-114)),GLHA_ACALA/24-117),GLHA_HUMAN/25-116),GLHA_HORSE/25-120,GLHA1_RAT/25-120);
RTL  1.74963
LNK  GLHA1_CYPCA/24-118:P01221:M37379
LNK  GLHA1_ONCKE/14-108:P13152:M27652
LNK  GLHA1_RAT/25-120:P11962:D00575
LNK  GLHA2_ONCTS/23-114:P69062:S77061
LNK  GLHA_ACALA/24-117:P30970:M94038
LNK  GLHA_ANGAN/25-117:P27794:X61038
LNK  GLHA_HORSE/25-120:P01220:AB000200
LNK  GLHA_HUMAN/25-116:P01215:J00152
LNK  GLHA_MACMU/25-120:P22762:
LNK  GLHA_RANCA/1-97:P80051:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  GLHA_RANCA/1-97
ASQ  FPDDNFLTPGCPECRLKENLRFSNMGIGrIYQCSGCCYSRAYPTPMRSKKTMLVPKNITSEAKCCVAKTQYRVTVMDNVKIENHTACHCSTCLYHKS
NAM  GLHA_MACMU/25-120
ASQ  FPDGEFTMQDCPECKPRENKFFSKPGAP.IYQCMGCCFSRAYPTPVRSKKTMLVQKNVTSESTCCVAKSLTRVMVMGSVRVENHTECHCSTCYYHKF
NAM  GLHA_HUMAN/25-116
ASQ  APD----VQDCPECTLQENPFFSQPGAP.ILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
DSQ  GCTCCTGAT------------GTGCAGGATTGCCCAGAATGCACGCTACAGGAAAACCCATTCTTCTCCCAGCCGGGTGCCCCA...ATACTTCAGTGCATGGGCTGCTGCTTCTCTAGAGCATATCCCACTCCACTAAGGTCCAAGAAGACGATGTTGGTCCAAAAGAACGTCACCTCAGAGTCCACTTGCTGTGTAGCTAAATCATATAACAGGGTCACAGTAATGGGGGGTTTCAAAGTGGAGAACCACACGGCGTGCCACTGCAGTACTTGTTATTATCACAAATCT
TRN  10010101110011001
NAM  GLHA1_RAT/25-120
ASQ  LPDGDLIIQGCPECKLKENKYFSKLGAP.IYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS
DSQ  CTTCCTGATGGAGACCTTATTATTCAGGGTTGTCCAGAATGTAAACTAAAGGAAAACAAATACTTCTCCAAGCTGGGTGCCCCC...ATCTATCAGTGTATGGGCTGTTGCTTCTCCAGGGCATACCCGACTCCCGCAAGGTCCAAGAAGACAATGTTGGTTCCAAAGAATATTACCTCGGAGGCCACGTGCTGTGTGGCCAAATCATTTACTAAGGCCACAGTGATGGGAAACGCCAGAGTGGAGAACCACACGGACTGCCACTGTAGCACTTGTTACTACCACAAGTCG
TRN  10010101100011001
NAM  GLHA_HORSE/25-120
ASQ  FPDGEFTTQDCPECKLRENKYFFKLGVP.IYQCKGCCFSRAYPTPARSRKTMLVPKNITSESTCCVAKAFIRVTVMGNIKLENHTQCYCSTCYHHKI
DSQ  TTTCCTGATGGAGAGTTTACAACGCAGGATTGCCCAGAATGCAAGCTAAGGGAAAACAAGTACTTCTTCAAACTGGGCGTCCCG...ATTTACCAGTGTAAGGGCTGCTGCTTCTCCAGAGCGTACCCCACTCCAGCAAGGTCCAGGAAGACAATGTTGGTCCCAAAGAACATCACCTCAGAATCCACATGCTGTGTGGCCAAAGCATTTATCAGGGTCACAGTGATGGGAAACATCAAGTTGGAGAACCACACCCAGTGCTATTGCAGCACTTGCTATCACCACAAGATT
TRN  10010101100011001
NAM  GLHA_ANGAN/25-117
ASQ  YPNNEMARGGCDECRLQENKIFSKPSAP.IFQCVGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAR---EVTRLDNMKLENHTDCHCSTCYYHKF
DSQ  TATCCCAACAACGAAATGGCACGAGGTGGCTGCGATGAATGCCGACTCCAGGAGAATAAGATCTTCTCCAAGCCCAGCGCTCCA...ATCTTCCAGTGCGTTGGGTGCTGTTTCTCCAGGGCGTACCCAACACCACTGCGGTCCAAGAAGACCATGCTGGTGCCAAAGAACATCACATCTGAGGCAACGTGCTGCGTGGCCAGG---------GAGGTGACAAGGCTGGATAACATGAAACTGGAGAACCACACAGACTGCCACTGCAGCACCTGCTACTACCACAAATTT
TRN  10010101100011011
NAM  GLHA2_ONCTS/23-114
ASQ  YPNSDKTNMGCEECTLKPNTIFPN----.IMQCTGCCFSRAYPTPLRSKQTMLVPKNITSEATCCVAKEGERVTTKDGFPVTNHTECHCSTCYYHKS
DSQ  TATCCAAACAGTGACAAGACAAACATGGGCTGTGAGGAATGCACACTGAAGCCGAACACAATCTTCCCCAAC------------...ATCATGCAGTGTACAGGCTGCTGCTTCTCCAGAGCTTATCCAACCCCACTACGGTCCAAGCAAACCATGCTGGTCCCCAAGAACATCACCTCTGAAGCCACATGCTGTGTTGCAAAAGAAGGGGAAAGGGTCACCACCAAGGATGGCTTCCCGGTGACGAACCACACAGAGTGTCACTGCAGCACCTGTTATTACCATAAATCA
TRN  10010101100011001
NAM  GLHA1_ONCKE/14-108
ASQ  YQNSDMTNVGCEECKLKENKVFSNPGAP.VYQCTGCCFSRAYPTPLQSKKAMLVPKNITSEATCCVAKEGERVVVDN-IKLTNHTECWCNTCYHHKS
DSQ  TATCAAAACAGTGACATGACAAACGTGGGCTGTGAGGAATGCAAACTGAAGGAGAACAAAGTATTCTCTAACCCGGGCGCCCCT...GTCTACCAGTGTACAGGCTGCTGCTTTTCCAGAGCTTATCCAACCCCACTGCAGTCTAAGAAAGCCATGTTGGTCCCAAAGAACATCACCTCTGAAGCCACATGCTGCGTTGCAAAAGAAGGGGAAAGGGTGGTGGTGGATAAC---ATCAAGCTGACAAACCACACAGAGTGTTGGTGCAACACCTGTTATCACCATAAGTCA
TRN  10010101100011001
NAM  GLHA1_CYPCA/24-118
ASQ  YPRNDMNNFGCEECKLKENNIFSKPGAP.VYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAK-EVKRVLVNDVKLVNHTDCHCSTCYYHKS
DSQ  TATCCAAGAAATGATATGAATAACTTTGGATGTGAGGAGTGCAAACTCAAGGAGAACAACATTTTCTCAAAACCTGGAGCTCCT...GTCTATCAGTGTATGGGATGCTGTTTTTCTAGGGCTTACCCCACGCCCCTGAGGTCCAAGAAAACCATGCTTGTTCCAAAAAATATCACATCAGAAGCTACATGCTGTGTAGCCAAA---GAAGTTAAGCGGGTGCTTGTCAATGATGTCAAACTAGTGAACCACACAGACTGCCACTGCAGCACCTGCTACTATCATAAGTCT
TRN  10010101100011001
NAM  GLHA_ACALA/24-117
ASQ  YPNTDLSNMGCEACTLRKNTVFSR-DRP.IYQCMGCCFSRAYPTPLKAMKTMTIPKNITSEATCCVAKHVYETEVAG-IRVRNHTDCHCSTCYYHKI
DSQ  TACCCCAACACTGACTTATCGAACATGGGCTGTGAGGCGTGCACGCTGCGAAAGAACACTGTTTTCTCCAGG---GATCGTCCG...ATTTACCAGTGCATGGGCTGCTGCTTCTCCAGAGCGTACCCAACGCCTCTCAAGGCCATGAAGACGATGACGATCCCGAAGAACATCACCTCCGAGGCTACATGCTGCGTCGCAAAGCACGTCTACGAGACAGAGGTGGCCGGC---ATAAGGGTGAGGAACCACACAGACTGCCACTGCAGCACCTGCTACTATCATAAGATA
TRN  10010101100011010
//