EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00201 - UDPGT)
FAM  PF00201
PID  UDPGT
DES  UDP-glucoronosyl and UDP-glucosyl transferase
IPR  IPR002213
ANO  14
ALN  516
AID  0.459901
APH  ((((UDBE_RABIT/25-528:0.17703,((UDB2_RAT/24-528:0.16004,UDBC_RAT/24-528:0.10351):0.17089,((UDB4_HUMAN/24-526:0.12335,UDBF_HUMAN/24-528:0.13571):0.04859,UDB1_RAT/24-528:0.22079):0.06451):0.03567):0.07753,UDBD_RABIT/25-529:0.11556):0.33825,((UD16_HUMAN/27-524:0.20112,UD12_HUMAN/26-522:0.26512):0.06405,(UD11_HUMAN/28-525:0.16739,(UD12_RAT/28-525:0.17527,UD13_HUMAN/29-526:0.09185):0.10101):0.03592):0.32779):2.54527,UFO1_MAIZE/26-471:0.07877,UFOG_HORVU/20-455:0.21313);
ATP  ((((UDBE_RABIT/25-528,((UDB2_RAT/24-528,UDBC_RAT/24-528),((UDB4_HUMAN/24-526,UDBF_HUMAN/24-528),UDB1_RAT/24-528))),UDBD_RABIT/25-529),((UD16_HUMAN/27-524,UD12_HUMAN/26-522),(UD11_HUMAN/28-525,(UD12_RAT/28-525,UD13_HUMAN/29-526)))),UFO1_MAIZE/26-471,UFOG_HORVU/20-455);
ATL  5.98453
DNO  14
DLN  1548
DID  0.550579
DPH  ((((((UDB4_HUMAN/24-526:0.08087,UDBF_HUMAN/24-528:0.08859):0.03828,UDB1_RAT/24-528:0.17237):0.02768,(UDBD_RABIT/25-529:0.12941,UDBE_RABIT/25-528:0.09886):0.04247):0.04185,(UDB2_RAT/24-528:0.09647,UDBC_RAT/24-528:0.06015):0.09700):0.45790,((((UD12_RAT/28-525:0.16916,UD13_HUMAN/29-526:0.04708):0.08968,UD11_HUMAN/28-525:0.13335):0.06399,UD16_HUMAN/27-524:0.14683):0.05873,UD12_HUMAN/26-522:0.14709):0.07004):1.35867,UFO1_MAIZE/26-471:0.17121,UFOG_HORVU/20-455:0.05522);
DTP  ((((((UDB4_HUMAN/24-526,UDBF_HUMAN/24-528),UDB1_RAT/24-528),(UDBD_RABIT/25-529,UDBE_RABIT/25-528)),(UDB2_RAT/24-528,UDBC_RAT/24-528)),((((UD12_RAT/28-525,UD13_HUMAN/29-526),UD11_HUMAN/28-525),UD16_HUMAN/27-524),UD12_HUMAN/26-522)),UFO1_MAIZE/26-471,UFOG_HORVU/20-455);
DTL  3.98301
RID  0.459901
RPH  ((((UDBE_RABIT/25-528:0.17703,((UDB2_RAT/24-528:0.16004,UDBC_RAT/24-528:0.10351):0.17089,((UDB4_HUMAN/24-526:0.12335,UDBF_HUMAN/24-528:0.13571):0.04859,UDB1_RAT/24-528:0.22079):0.06451):0.03567):0.07753,UDBD_RABIT/25-529:0.11556):0.33825,((UD16_HUMAN/27-524:0.20112,UD12_HUMAN/26-522:0.26512):0.06405,(UD11_HUMAN/28-525:0.16739,(UD12_RAT/28-525:0.17527,UD13_HUMAN/29-526:0.09185):0.10101):0.03592):0.32779):2.54527,UFO1_MAIZE/26-471:0.07877,UFOG_HORVU/20-455:0.21313);
RTP  ((((UDBE_RABIT/25-528,((UDB2_RAT/24-528,UDBC_RAT/24-528),((UDB4_HUMAN/24-526,UDBF_HUMAN/24-528),UDB1_RAT/24-528))),UDBD_RABIT/25-529),((UD16_HUMAN/27-524,UD12_HUMAN/26-522),(UD11_HUMAN/28-525,(UD12_RAT/28-525,UD13_HUMAN/29-526)))),UFO1_MAIZE/26-471,UFOG_HORVU/20-455);
RTL  5.98453
LNK  UD11_HUMAN/28-525:P22309:M57899
LNK  UD12_HUMAN/26-522:P36509:S55985
LNK  UD12_RAT/28-525:P20720:M34007
LNK  UD13_HUMAN/29-526:P35503:AF297093
LNK  UD16_HUMAN/27-524:P19224:AF297093
LNK  UDB1_RAT/24-528:P09875:M13506
LNK  UDB2_RAT/24-528:P08541:J02589
LNK  UDB4_HUMAN/24-526:P06133:AJ005162
LNK  UDBC_RAT/24-528:P36511:U06273
LNK  UDBD_RABIT/25-529:P36512:L01081
LNK  UDBE_RABIT/25-528:P36513:L01082
LNK  UDBF_HUMAN/24-528:P54855:AF548389
LNK  UFO1_MAIZE/26-471:P16166:X13500
LNK  UFOG_HORVU/20-455:P14726:X15694
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.....xxxxxxxxxx....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  UFOG_HORVU/20-455
ASQ  AVLFSFARALAAAAP-AGTSLSFLTTADNAAQLRKAG------ALPGNLRFVEVPDGVPPGETSCLSPPRRMDLFMAAAEAGGVRVGLEAAC----ASAGGARVSC--VVGDAFVW-TADAASAAGAPWVAVWT-AASCALLAHLRTDALRRDVGDQAASRADELLVAHAGLGGYRVRDLPDGVVSGD--FNYVISLLVHRQAQRLPKA---ATAVALNTFPGLDPPDLIAALAAELPNCLPLG-PYHLLPGAEPTADTNEAPADPHGCLAWLDRRP--ARSVAYVSFGTNATARPDE-LQELAAGLEASGAPFLWSLRGvv.aaAPRGFLERAP....GLVVPWAPQVGVLRHAAVGAFVTHAGWASVMEGVSSGVPMACRPFFGDQTMNARSVASVWGFGTAFDGPMTRGAVANAVATLLRGE----------------------------------DGER-MRAKAQ---------------ELQAMVGKAFEPDGGCRKNFDEFVEIVCRV-
DSQ  GCCGTGCTCTTCTCGTTCGCGCGCGCCCTCGCCGCCGCCGCGCCG---GCCGGGACGAGCCTCTCGTTCCTCACCACCGCCGACAACGCCGCCCAGCTCCGCAAGGCCGGC------------------GCGCTCCCCGGCAACCTGCGCTTCGTCGAGGTCCCGGACGGGGTGCCGCCGGGCGAGACGTCGTGCCTGTCGCCTCCGCGCCGGATGGATCTCTTCATGGCGGCGGCCGAGGCCGGCGGGGTCAGGGTCGGGCTCGAGGCGGCATGC------------GCCTCCGCCGGTGGCGCCAGGGTGAGCTGC------GTCGTCGGGGACGCGTTCGTCTGG---ACCGCGGACGCGGCCTCCGCTGCCGGGGCGCCGTGGGTGGCCGTCTGGACC---GCCGCTTCCTGCGCCCTCCTCGCGCACCTCCGCACCGACGCGCTCCGCCGGGACGTCGGCGATCAGGCCGCCAGCCGAGCCGACGAGCTGCTGGTCGCGCACGCCGGCCTCGGCGGCTACCGCGTCCGGGACCTCCCCGACGGCGTCGTCTCCGGCGAC------TTCAACTACGTCATCAGCCTCCTGGTCCACCGCCAGGCGCAGCGCCTTCCTAAAGCG---------GCCACGGCCGTCGCCCTCAACACCTTCCCGGGCCTCGACCCGCCCGACCTCATCGCCGCCCTCGCCGCCGAGCTCCCGAACTGCCTGCCCCTCGGC---CCCTACCACCTCCTCCCGGGCGCAGAGCCCACAGCAGACACCAACGAAGCGCCAGCCGACCCGCACGGCTGCCTCGCCTGGCTCGACCGCCGGCCC------GCGCGGTCCGTCGCGTACGTCAGCTTCGGCACGAACGCCACGGCGCGGCCGGACGAG---CTGCAGGAGCTCGCGGCCGGGCTGGAGGCGAGCGGCGCGCCGTTCCTGTGGTCGCTGCGCGGAgtcgtg...gccgctGCTCCCCGGGGGTTCCTGGAGCGCGCGCCG............GGCCTCGTGGTGCCGTGGGCGCCGCAGGTGGGCGTGCTGCGGCACGCCGCGGTCGGCGCGTTCGTGACGCACGCCGGGTGGGCGTCGGTGATGGAGGGAGTGTCCAGCGGCGTGCCCATGGCGTGCCGGCCCTTCTTCGGCGACCAGACGATGAACGCGCGGTCGGTGGCCAGTGTGTGGGGCTTCGGCACGGCGTTCGACGGGCCGATGACGCGCGGCGCCGTGGCAAACGCGGTGGCGACGCTGCTGCGCGGGGAG------------------------------------------------------------------------------------------------------GATGGGGAGCGG---ATGAGGGCAAAGGCGCAG---------------------------------------------GAGCTGCAGGCCATGGTGGGCAAGGCGTTCGAGCCCGACGGCGGCTGCAGGAAGAACTTCGACGAGTTTGTCGAGATAGTTTGTCGGGTG---
TRN  10010101100011011
NAM  UFO1_MAIZE/26-471
ASQ  AVLLSIARALAAAAAPSGATLSFLSTASSLAQLRKASSASAGHGLPGNLRFVEVPDGAPAAEETVPVP-RQMQLFMEAAEAGGVKAWLEAAR----AAAGGARVTC--VVGDAFVWPAADAAASAGAPWVPVWT-AASCALLAHIRTDALREDVGDQAANRVDGLLISHPGLASYRVRDLPDGVVSGD--FNYVINLLVHRMGQCLPRS---AAAVALNTFPGLDPPDVTAALAEILPNCVPFG-PYHLLL-AEDDADT-AAPADPHGCLAWLGRQP--ARGVAYVSFGTVACPRPDE-LRELAAGLEDSGAPFLWSLREdswphLPPGFLDRAAgtgsGLVVPWAPQVAVLRHPSVGAFVTHAGWASVLEGLSSGVPMACRPFFGDQRMNARSVAHVWGFGAAFEGAMTSAGVATAVEELLRGE----------------------------------EGAR-MRARAK---------------ELQALVAEAFGPGGECRKNFDRFVEIVCRA-
DSQ  GCGGTGCTGCTCTCCATCGCGCGCGCCCTGGCTGCCGCCGCGGCGCCGTCCGGGGCCACGCTCTCGTTCCTCTCCACCGCGTCCTCCCTCGCGCAGCTCCGCAAGGCCAGCAGCGCCTCCGCCGGGCACGGGCTCCCGGGGAACCTGCGCTTCGTCGAGGTACCGGACGGCGCGCCCGCGGCCGAGGAGACCGTGCCGGTGCCG---CGGCAGATGCAGCTGTTCATGGAGGCCGCGGAGGCCGGCGGGGTGAAGGCCTGGCTGGAGGCGGCCCGC------------GCCGCGGCGGGCGGCGCCAGGGTGACCTGC------GTGGTGGGCGACGCGTTCGTGTGGCCGGCGGCGGACGCGGCCGCCTCCGCGGGGGCGCCGTGGGTGCCGGTGTGGACG---GCCGCGTCGTGCGCGCTCCTGGCGCACATCCGCACCGACGCGCTCCGGGAGGACGTTGGCGACCAGGCAGCAAACAGGGTGGACGGGCTACTGATCTCCCACCCGGGCCTCGCCAGCTACCGCGTCCGTGACCTCCCAGACGGCGTCGTCTCCGGCGAC------TTCAACTACGTCATCAACCTCCTCGTCCACCGCATGGGGCAGTGCCTCCCGCGCTCT---------GCCGCCGCCGTGGCACTCAACACGTTCCCAGGCCTGGACCCGCCCGACGTCACCGCGGCGCTCGCGGAGATCCTGCCCAACTGCGTCCCGTTCGGC---CCCTACCACCTCCTCCTC---GCCGAGGACGACGCCGACACC---GCCGCACCAGCCGACCCGCACGGCTGCCTCGCCTGGCTGGGCCGCCAACCC------GCGCGCGGCGTCGCGTACGTCAGCTTCGGCACGGTGGCGTGCCCGCGGCCCGACGAG---CTCCGCGAGCTGGCGGCCGGGCTGGAGGACTCGGGCGCGCCGTTCCTGTGGTCGCTGCGCGAGgactcgtggccgcacCTCCCGCCGGGTTTCCTGGACCGCGCCGCGggcaccgggtccGGGCTCGTGGTGCCCTGGGCGCCGCAGGTGGCCGTGCTGCGCCACCCTTCCGTGGGCGCGTTCGTGACGCACGCCGGGTGGGCGTCGGTGCTGGAGGGCTTGTCCAGCGGGGTGCCCATGGCGTGCCGCCCCTTCTTCGGCGACCAGCGGATGAACGCGCGGTCCGTGGCGCACGTGTGGGGGTTCGGCGCCGCGTTCGAGGGCGCTATGACGAGCGCCGGAGTGGCCACGGCCGTGGAGGAGCTGCTGCGCGGGGAG------------------------------------------------------------------------------------------------------GAAGGGGCGCGG---ATGAGGGCAAGGGCCAAG---------------------------------------------GAGCTGCAGGCCTTGGTGGCCGAGGCGTTCGGGCCAGGCGGTGAGTGCAGGAAGAACTTCGACAGGTTCGTCGAGATAGTCTGTCGCGCG---
TRN  10010101100011011
NAM  UDBE_RABIT/25-528
ASQ  GKVLVWPMDFSLWMNLNVILDELVRRGHEVIVLRNSASIFIDPSKQANIKFETFPIAATKDDLEDLFVHYVSTWTN-ARQ-NSQWKYFSLLQKLFSEYSDSCENACKEVVFNKTLMTKLQESRFDILLSDAIGPCGELLAELLKIPFVYSLRFTPGYTMEKYSGGLSVPPSYVPIILSDLSGKMTFMERVNNMLCMLYFDFWFQMFNKKRWDQFYSEVLGRPVTFSELVGKADMWLIRSYWDLEFPRPTLPNIQFVGGLHCKPAKPLPKEMEEFVQSSGEEGVVVFSLGSMVSNMTEERANLIASAFAQLPQKVIWRFDG.....QKPETLGPNT....-RIYDWIPQNDLLGHPKTKAFVTHGGANGIYEAIHHGIPMVGLPLFGEQPDNIAHMTAKGAAIRLNWKTMSSEDLLNALKTVINDPSYKENVMTLSSIHHDQPMKPLDRAVFWIEYVMRHKGAKHLRVAAHDLTWFQYHSLDVVGFLVSCAAFLIFLVIKSYLFVYQKLVKIGKKQK
DSQ  GGAAAGGTGCTGGTGTGGCCCATGGACTTCAGTCTCTGGATGAATTTAAATGTAATCCTGGATGAACTTGTCCGGAGAGGTCATGAGGTGATTGTTCTGAGAAATTCAGCTTCCATTTTCATTGATCCAAGCAAACAAGCTAATATTAAATTTGAAACTTTTCCTATTGCTGCCACCAAAGATGACCTGGAAGATTTATTTGTACACTATGTTAGTACATGGACAAAT---GCACGCCAG---AACTCACAATGGAAATATTTTTCACTACTGCAAAAGCTCTTTTCAGAATATTCTGACAGTTGTGAAAATGCCTGTAAAGAAGTAGTTTTCAACAAGACACTCATGACAAAGCTACAAGAGTCAAGATTTGACATCCTTCTATCAGATGCTATTGGTCCTTGTGGTGAGCTGCTGGCCGAGCTGCTTAAAATACCCTTTGTGTACAGTCTCCGCTTCACTCCCGGCTACACTATGGAAAAATACAGTGGAGGACTTTCAGTTCCTCCTTCCTATGTTCCTATTATTCTTTCTGATTTAAGTGGGAAAATGACATTCATGGAGAGGGTAAACAATATGCTATGTATGCTTTATTTTGACTTCTGGTTTCAAATGTTTAATAAGAAGAGGTGGGACCAATTTTATAGTGAAGTACTAGGAAGACCTGTTACATTCTCAGAGCTAGTGGGGAAAGCTGACATGTGGCTCATTCGAAGCTACTGGGACTTGGAGTTTCCTCGCCCAACCTTACCAAATATTCAATTTGTTGGAGGGCTCCACTGCAAACCTGCCAAACCTCTGCCCAAGGAAATGGAAGAGTTTGTGCAGAGCTCTGGAGAAGAGGGAGTTGTGGTGTTTTCCCTGGGGTCCATGGTCAGCAACATGACAGAAGAAAGGGCCAATTTGATTGCATCGGCCTTTGCCCAGCTTCCACAAAAGGTTATATGGAGATTTGATGGC...............CAGAAACCAGAAACATTAGGACCCAACACT............---CGGATCTATGACTGGATCCCCCAGAATGATCTTCTTGGTCATCCAAAAACCAAAGCCTTTGTAACTCATGGTGGAGCCAATGGCATCTATGAGGCAATCCACCATGGCATCCCTATGGTGGGACTTCCTTTGTTTGGGGAGCAACCTGATAATATTGCCCACATGACGGCCAAGGGGGCAGCCATTAGGCTGAACTGGAAAACAATGTCAAGTGAAGATTTGCTCAATGCCTTGAAGACAGTCATCAATGACCCCTCCTATAAAGAGAATGTCATGACATTATCCAGTATTCACCATGATCAGCCCATGAAGCCCCTGGATCGAGCAGTCTTCTGGATCGAGTATGTCATGCGGCACAAAGGAGCAAAACACCTTAGGGTTGCAGCCCACGACCTCACCTGGTTCCAGTACCACTCTTTGGATGTGGTTGGGTTCCTGGTGTCCTGTGCAGCATTTCTGATTTTTCTTGTCATAAAGAGTTATTTGTTTGTCTATCAAAAGCTTGTTAAGATAGGAAAGAAGCAGAAG
TRN  10010101100011000
NAM  UDBD_RABIT/25-529
ASQ  GKVLVWPMEFSHWMNMKTILDALVQQGHEVTVLRSSASIVIGSNNESGIKFETFHTSYRKDEIENFFMDWFYKMIYNVSI-ESYWETFSLTKMVILKYSDICEDICKEVILNKKLMTKLQESRFDVVLADPVSPGGELLAELLKIPLVYSLRGFVGYMLQKHGGGLLLPPSYVPVMMSGLGSQMTFMERVQNLLCVLYFDFWFPKFNEKRWDQFYSEVLGRPVTFLELMGKADMWLIRSYWDLEFPRPLLPNFDFIGGLHCKPAKPLPQEMEDFVQSSGEEGVVVFSLGSMISNLTEERANVIASALAQLPQKVLWRFEG.....KKPDMLGSNT....-RLYKWIPQNDLLGHPKTKAFITHGGANGVFEAIYHGIPMVGLPLFGDQLDNIVYMKAKGAAVKLNLKTMSSADLLNALKTVINDPSYKENAMTLSRIHHDQPMKPLDRAVFWIEYVMRHKGAKHLRVAAHDLTWYQYHSLDVIGFLLACVAITTYLIVKCCLLVYRYVLGAGKKKK
DSQ  GGAAAGGTGCTGGTGTGGCCTATGGAATTCAGTCACTGGATGAATATGAAGACAATCCTGGATGCACTTGTCCAGCAAGGCCATGAAGTCACTGTCCTGAGATCTTCAGCTTCTATTGTAATTGGTTCCAACAATGAATCAGGAATTAAATTTGAAACTTTCCATACATCCTACAGGAAAGATGAAATCGAGAATTTTTTCATGGATTGGTTCTATAAAATGATATATAATGTGTCAATA---GAGAGTTACTGGGAAACCTTTTCATTAACGAAAATGGTTATTTTAAAATATTCTGACATTTGTGAAGACATCTGTAAAGAAGTCATTTTGAACAAGAAACTCATGACAAAGCTGCAGGAATCAAGATTTGATGTTGTTCTTGCAGATCCTGTTAGTCCTGGTGGTGAGCTGCTGGCTGAGCTACTTAAAATACCCCTCGTGTACAGTCTTCGTGGCTTTGTTGGCTACATGTTGCAAAAGCATGGTGGAGGACTCTTACTGCCTCCTTCCTATGTACCTGTTATGATGTCTGGTCTAGGCAGTCAAATGACATTCATGGAGAGGGTGCAAAATCTGCTATGCGTGCTTTACTTTGACTTTTGGTTCCCAAAATTTAATGAGAAACGATGGGATCAATTTTACAGTGAAGTACTGGGAAGACCTGTTACGTTCTTGGAGCTAATGGGGAAAGCTGACATGTGGCTCATTCGAAGCTACTGGGACTTGGAGTTTCCTCGGCCACTTTTACCAAACTTTGATTTCATCGGAGGGCTCCACTGCAAACCTGCCAAACCTCTGCCTCAGGAGATGGAAGACTTTGTGCAGAGCTCTGGAGAAGAGGGAGTGGTGGTGTTTTCCCTGGGGTCCATGATCAGTAACCTGACTGAAGAAAGGGCCAATGTGATTGCATCAGCTCTTGCCCAGCTGCCACAAAAGGTTCTTTGGCGATTTGAAGGC...............AAGAAACCAGACATGTTAGGATCCAACACT............---CGGCTCTATAAGTGGATCCCCCAGAATGACCTTCTTGGTCATCCAAAAACCAAGGCTTTTATAACTCATGGTGGAGCCAATGGTGTCTTCGAGGCAATTTACCATGGCATTCCCATGGTGGGCCTTCCTTTGTTTGGAGATCAACTTGATAACATTGTCTACATGAAGGCCAAGGGAGCAGCTGTTAAGTTGAACTTGAAAACAATGTCCAGTGCAGATTTGCTCAATGCCTTGAAGACAGTCATTAATGACCCTTCCTATAAGGAGAACGCCATGACATTATCAAGAATTCACCACGATCAGCCCATGAAGCCGCTGGACCGAGCAGTCTTCTGGATCGAGTACGTCATGCGCCACAAAGGAGCCAAACATCTCCGGGTTGCAGCCCATGACCTCACCTGGTACCAGTACCACTCTCTGGATGTGATTGGGTTCCTGCTGGCCTGTGTGGCAATCACTACTTACCTTATCGTGAAATGTTGCCTTCTTGTTTATCGATATGTTCTTGGGGCAGGAAAGAAGAAAAAG
TRN  10010101100011000
NAM  UDB1_RAT/24-528
ASQ  GKVLVWPTEYSHWINIKIILNELAQRGHEVTVLVSSASILIEPTKESSINFEIYSVPLSKSDLEYSFAKWIDEWTRDFET-LSIWTYYSKMQKVFNEYSDVVENLCKALIWNKSLMKKLQGSQFDVILADAVGPCGELLAELLKTPLVYSLRFCPGYRCEKFSGGLPLPPSYVPVVLSELSDRMTFVERVKNMLQMLYFDFWFQPFKEKSWSQFYSDVLGRPTTLTEMMGKADIWLIRTFWDLEFPHPFLPNFDFVGGLHCKPAKPLPREMEEFVQSSGEHGVVVFSLGSMVKNLTEEKANVVASALAQIPQKVVWRFDG.....KKPDTLGSNT....-RLYKWIPQNDLLGHPKTKAFVAHGGTNGIYEAIYHGIPIVGIPLFADQPDNINHMVAKGAAVRVDFSILSTTGLLTALKIVMNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEYVMRHKGAKHLRSTLHDLSWFQYHSLDVIGFLLLCVVGVVFIITKFCLFCCRKTANMGKKKK
DSQ  GGAAAAGTGCTAGTGTGGCCCACAGAATACAGCCACTGGATTAATATAAAGATAATTCTGAATGAACTTGCCCAGAGAGGTCATGAAGTCACGGTTCTTGTATCTTCGGCTTCCATTCTCATTGAGCCTACCAAGGAATCTTCTATTAATTTTGAGATTTACTCTGTACCTTTGAGTAAAAGTGATCTTGAATATAGTTTTGCAAAATGGATAGATGAATGGACACGTGATTTTGAAACA---CTCTCGATTTGGACATATTATTCAAAAATGCAAAAAGTCTTCAATGAATATTCTGATGTCGTTGAAAATTTATGCAAAGCACTCATTTGGAACAAGAGTCTTATGAAAAAACTCCAAGGATCTCAATTTGATGTCATTCTCGCAGATGCTGTGGGTCCCTGTGGTGAGCTGCTAGCAGAACTGCTTAAGACACCTTTAGTGTACAGTCTCCGCTTCTGTCCTGGATACAGATGTGAAAAGTTCAGTGGGGGACTTCCACTGCCTCCTTCCTATGTGCCTGTTGTTCTTTCAGAATTAAGTGACCGCATGACATTTGTGGAAAGAGTGAAGAATATGTTGCAGATGCTGTATTTTGACTTTTGGTTTCAACCATTTAAAGAGAAGTCCTGGAGTCAGTTTTACAGTGATGTTCTAGGTAGACCCACAACATTAACTGAGATGATGGGGAAGGCAGATATATGGCTCATTCGAACCTTCTGGGACTTGGAATTTCCACACCCATTCTTACCTAATTTTGACTTTGTTGGAGGACTACATTGCAAACCAGCCAAACCACTGCCTAGGGAAATGGAAGAATTTGTTCAGAGCTCTGGAGAACATGGTGTAGTGGTGTTTTCTCTGGGATCAATGGTTAAAAACCTGACTGAAGAAAAAGCCAATGTAGTTGCTTCTGCTCTTGCCCAAATTCCACAGAAGGTTGTATGGAGATTTGATGGT...............AAGAAACCAGATACCTTAGGATCTAACACT............---CGGCTGTACAAGTGGATCCCCCAGAATGACCTTCTTGGTCATCCAAAAACCAAAGCTTTTGTAGCTCATGGTGGAACAAATGGCATCTATGAGGCAATCTACCATGGCATTCCTATTGTTGGTATTCCCTTGTTTGCAGATCAACCGGATAACATTAATCACATGGTAGCCAAAGGAGCTGCTGTTAGAGTTGACTTCAGCATACTGTCAACTACAGGCCTTCTCACTGCCTTGAAGATTGTCATGAATGACCCTTCCTATAAGGAGAATGCCATGAGATTATCCAGAATCCACCATGATCAGCCAGTGAAGCCCCTGGACCGAGCCGTCTTCTGGATCGAGTATGTCATGCGTCACAAAGGAGCCAAGCACCTCCGCTCAACTCTGCATGACCTTAGCTGGTTCCAGTACCACTCTCTGGATGTCATTGGGTTCCTATTGCTCTGTGTGGTAGGTGTGGTATTCATCATCACAAAATTCTGCCTCTTTTGTTGCCGTAAGACTGCTAACATGGGAAAGAAGAAGAAA
TRN  10010101100011000
NAM  UDBF_HUMAN/24-528
ASQ  GKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSSAIKLEVYPTSLTKNDLEDSLLKILDRWIYGVSK-NTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDG.....KKPNTLGSNT....-RLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATVIFIITKFCLFCFRKLAKTGKKKK
DSQ  GGAAAGGTGCTAGTGTGGCCCACAGAATACAGCCATTGGATAAATATGAAGACAATCCTGGAAGAGCTTGTTCAGAGGGGTCATGAGGTGACTGTGTTGACATCTTCGGCTTCTACTCTTGTCAATGCCAGTAAATCATCTGCTATTAAATTAGAAGTTTATCCTACATCTTTAACTAAAAATGATTTGGAAGATTCTCTTCTGAAAATTCTCGATAGATGGATATATGGTGTTTCAAAA---AATACATTTTGGTCATATTTTTCACAATTACAAGAATTGTGTTGGGAATATTATGACTACAGTAACAAGCTCTGTAAAGATGCAGTTTTGAATAAGAAACTTATGATGAAACTACAAGAGTCAAAGTTTGATGTCATTCTGGCAGATGCCCTTAATCCCTGTGGTGAGCTACTGGCTGAACTATTTAACATACCCTTTCTGTACAGTCTTCGATTCTCTGTTGGCTACACATTTGAGAAGAATGGTGGAGGATTTCTGTTCCCTCCTTCCTATGTACCTGTTGTTATGTCAGAATTAAGTGATCAAATGATTTTCATGGAGAGGATAAAAAATATGATACATATGCTTTATTTTGACTTTTGGTTTCAAATTTATGATCTGAAGAAGTGGGACCAGTTTTATAGTGAAGTTCTAGGAAGACCCACTACATTATTTGAGACAATGGGGAAAGCTGAAATGTGGCTCATTCGAACCTATTGGGATTTTGAATTTCCTCGCCCATTCTTACCAAATGTTGATTTTGTTGGAGGACTTCACTGTAAACCAGCCAAACCCCTGCCTAAGGAAATGGAAGAGTTTGTGCAGAGCTCTGGAGAAAATGGTATTGTGGTGTTTTCTCTGGGGTCGATGATCAGTAACATGTCAGAAGAAAGTGCCAACATGATTGCATCAGCCCTTGCCCAGATCCCACAAAAGGTTCTATGGAGATTTGATGGC...............AAGAAGCCAAATACTTTAGGTTCCAATACT............---CGACTGTACAAGTGGTTACCCCAGAATGACCTTCTTGGTCATCCCAAAACCAAAGCTTTTATAACTCATGGTGGAACCAATGGCATCTATGAGGCGATCTACCATGGGATCCCTATGGTGGGCATTCCCTTGTTTGCGGATCAACATGATAACATTGCTCACATGAAAGCCAAGGGAGCAGCCCTCAGTGTGGACATCAGGACCATGTCAAGTAGAGATTTGCTCAATGCATTGAAGTCAGTCATTAATGACCCTGTCTATAAAGAGAATGTCATGAAATTATCAAGAATTCATCATGACCAACCAATGAAGCCCCTGGATCGAGCAGTCTTCTGGATTGAGTTTGTCATGCGCCACAAAGGAGCCAAGCACCTTCGAGTCGCAGCTCACAACCTCACCTGGATCCAGTACCACTCTTTGGATGTGATAGCATTCCTGCTGGCCTGCGTGGCAACTGTGATATTTATCATCACAAAATTTTGCCTGTTTTGTTTCCGAAAGCTTGCCAAAACAGGAAAGAAGAAGAAA
TRN  10010101100011000
NAM  UDB4_HUMAN/24-526
ASQ  GKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFEDIIKQLVKRWAE-LPK-DTFWSYFSQVQEIMWTFNDILRKFCKDIVSNKKLMKKLQESRFDVVLADAVFPFGELLAELLKIPFVYSLRFSPGYAIEKHSGGLLFPPSYVPVVMSELSDQMTFIERVKNMIYVLYFEFWFQIFDMKKWDQFYSEVLGRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDG.....NKPDTLGLNT....-RLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTMSSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVTGFLLACVATVIFIITK-CLFCVWKFVRTGKKGK
DSQ  GGAAAGGTGCTGGTGTGGCCCACAGAATTCAGCCACTGGATGAATATAAAGACAATCCTGGATGAACTTGTCCAGAGAGGTCATGAGGTGACTGTATTGGCATCTTCAGCTTCCATTTCTTTCGATCCCAACAGCCCATCTACTCTTAAATTTGAAGTTTATCCTGTATCTTTAACTAAAACTGAGTTTGAGGATATTATCAAGCAGCTGGTTAAGAGATGGGCAGAA---CTTCCAAAA---GACACATTTTGGTCATATTTTTCACAAGTACAAGAAATCATGTGGACATTTAATGACATACTTAGAAAGTTCTGTAAGGATATAGTTTCAAATAAGAAACTTATGAAGAAACTACAGGAGTCAAGATTTGATGTTGTTCTTGCAGATGCTGTTTTCCCCTTTGGTGAGCTGCTGGCCGAGTTACTTAAAATACCCTTTGTCTACAGCCTCCGCTTCTCTCCTGGCTACGCAATTGAAAAGCATAGTGGAGGACTTCTGTTCCCTCCTTCCTATGTGCCTGTTGTTATGTCAGAACTAAGTGACCAAATGACTTTCATAGAGAGGGTAAAAAATATGATCTATGTGCTTTATTTTGAATTTTGGTTCCAAATATTTGACATGAAGAAGTGGGATCAGTTCTACAGTGAAGTTCTAGGAAGACCCACTACGTTATCTGAGACAATGGCAAAAGCTGACATATGGCTTATTCGAAACTACTGGGATTTTCAATTTCCTCACCCACTCTTACCAAATGTTGAGTTCGTTGGAGGACTCCACTGCAAACCTGCCAAACCCCTACCGAAGGAAATGGAAGAGTTTGTCCAGAGCTCTGGAGAAAATGGTGTTGTGGTGTTTTCTCTGGGGTCGATGGTCAGTAACACGTCAGAAGAAAGGGCCAATGTAATTGCATCAGCCCTTGCCAAGATCCCACAAAAGGTTCTGTGGAGATTTGATGGG...............AATAAACCAGATACTTTAGGACTCAATACT............---CGGCTGTACAAGTGGATACCCCAGAATGATCTTCTTGGTCACCCAAAAACCAGAGCTTTTATAACTCATGGTGGAGCCAATGGCATCTATGAGGCAATCTACCATGGAATCCCTATGGTGGGCGTTCCATTGTTTGCAGATCAACCTGATAACATTGCACACATGAAGGCCAAGGGAGCAGCTGTTAGTTTGGACTTCCACACAATGTCGAGTACAGACTTACTCAATGCACTGAAGACAGTAATTAATGATCCTTTATATAAAGAGAATGCTATGAAATTATCAAGAATTCATCATGATCAACCAGTGAAGCCCCTTGATCGAGCAGTCTTCTGGATTGAATTTGTCATGCGCCATAAAGGAGCCAAGCACCTTCGGGTTGCAGCCCACGACCTCACCTGGTTCCAGTACCACTCTTTGGATGTGACTGGGTTCCTGCTGGCCTGTGTGGCAACTGTGATATTCATCATCACAAAA---TGTCTGTTTTGTGTCTGGAAGTTTGTTAGAACAGGAAAGAAGGGGAAA
TRN  10010101100011000
NAM  UDBC_RAT/24-528
ASQ  GKVLVWPMEYSHWMNIKIILEELVQKGHEVTVLRPSAFVFLDPKETSDLKFVTFPTSFSSHDLENFFTRFVNVWTYELPR-DTCLSYFLYLQDTIDEYSDYCLTVCKEAVSNKQFMTKLQESKFDVVFSDAIGPCGELIAELLQIPFLYSLRFSPGYTIEQYIGGVLFPPSYVPMIFSGLAGQMTFIERVHNMICMLYFDFWFQTFREKKWDPFYSKTLGRPTTLAEIMGKAEMWLIRSYWDLEFPHPISPNVDYIGGLHCKPAKPLPKDIEDFVQSSGEHGVVVFSLGSMVRNMTEEKANIIAWALAQIPQKVLWRFDG.....KKPPTLGPNT....-RLYKWLPQNDLLGHPKTKAFVTHGGANGIYEAIHHGIPMIGIPLFAEQHDNIAHMVAKGAAVEVNFRTMSKSDLLNALEEVIDNPFYKKNAMWLSTIHHDQPTKPLDRAVFWIEFVMRHKGAKHLRSLGHNLPWYQYHSLDVIGFLLSCVAVTVVLALKCFLFVYRFFVKKEKKTK
DSQ  GGAAAGGTGTTGGTATGGCCGATGGAATATAGTCACTGGATGAATATAAAGATAATACTGGAGGAACTTGTACAGAAGGGCCATGAAGTCACTGTTCTGAGACCTTCAGCTTTTGTCTTTCTTGATCCCAAGGAAACTTCTGACCTTAAATTTGTAACTTTTCCTACATCTTTCAGTAGTCATGACCTGGAAAATTTTTTTACAAGGTTTGTGAATGTATGGACTTATGAGTTGCCAAGA---GACACATGTTTGTCATATTTTCTTTATCTACAAGATACGATTGATGAATATTCTGACTACTGTCTGACTGTTTGTAAAGAAGCAGTTTCAAACAAACAGTTCATGACAAAACTACAGGAATCCAAATTTGATGTCGTTTTCTCAGATGCCATTGGTCCCTGTGGAGAGCTGATAGCTGAACTGCTCCAGATTCCTTTTCTGTACAGTCTTCGCTTCTCTCCTGGCTACACAATTGAACAGTACATTGGAGGAGTTCTATTCCCTCCCTCCTATGTACCCATGATTTTTTCAGGATTAGCTGGCCAAATGACATTCATAGAGAGGGTACACAATATGATATGTATGCTTTATTTTGACTTTTGGTTCCAAACATTTAGAGAGAAGAAATGGGATCCATTTTACAGCAAAACTTTAGGAAGGCCCACCACATTAGCTGAGATAATGGGCAAAGCAGAAATGTGGCTCATTAGATCCTACTGGGATTTGGAGTTTCCCCACCCAATATCGCCAAATGTTGACTACATTGGAGGACTCCACTGCAAACCTGCTAAACCCTTGCCCAAGGATATTGAAGACTTCGTCCAGAGCTCTGGAGAGCATGGTGTGGTGGTGTTTTCTCTGGGGTCAATGGTCAGGAACATGACAGAAGAAAAGGCCAACATCATTGCATGGGCCCTTGCCCAGATTCCACAAAAGGTTCTTTGGAGATTTGACGGC...............AAAAAACCACCCACCTTAGGACCCAATACC............---AGACTCTACAAGTGGCTTCCCCAAAATGATCTTCTTGGTCATCCAAAAACCAAAGCCTTTGTAACGCATGGTGGAGCCAATGGCATCTATGAGGCGATCCATCATGGAATCCCTATGATTGGCATTCCCTTATTTGCAGAGCAACATGATAACATTGCCCACATGGTGGCCAAAGGAGCAGCTGTGGAAGTAAATTTCAGGACAATGTCAAAGTCAGATTTGCTCAATGCACTGGAGGAAGTCATAGACAATCCTTTTTATAAAAAGAATGCTATGTGGTTGTCAACCATTCACCATGACCAGCCTACGAAGCCACTGGACAGAGCTGTCTTCTGGATTGAGTTTGTCATGCGCCACAAAGGGGCCAAGCACCTGAGATCACTTGGACATAACCTTCCCTGGTACCAGTACCACTCTCTGGATGTGATTGGATTCCTACTTTCCTGTGTGGCAGTCACTGTAGTCCTTGCTCTAAAGTGCTTTTTATTTGTTTATCGATTCTTTGTAAAGAAGGAAAAGAAAACAAAG
TRN  10010101100011000
NAM  UDB2_RAT/24-528
ASQ  GKVLVWPMDFSHWMNIKIILDELVQRGHEVTVLKPSAYFFLDPKKSSDLKFEIFSTSISKDELQNHFIKLLDVWTYELPR-DTCLSYSPILQNLVYEFSYFYLSICKDAVSNKQLMTKLQESKFDVLFADPVASCGDLIAELLHIPFLYSLSFSPGHKLEKSIGKFILPPSYVPVILSGLAGKMTFIDRVKNMICMLYFDFWFERLRHKEWDTFYSEILGRPTTVDETMSKVEIWLIRSYWDLKFPHPTLPNVDYIGGLHCKPAKPLPKDMEEFVQSSGEHGVVVFSLGSMVSNMTEEKANAIAWALAQIPQKVLWKFDG.....KTPATLGPNT....-RVYKWLPQNDLLGHPKTKAFVTHGGANGLYEAIYHGIPMIGIPLFGDQPDNIAHMVAKGAAVSLNIRTMSKLDFLSALEEVIDNPFYKKNVMLLSTIHHDQPMKPLDRAVFWIEFIMRHKGAKHLRPLGHNLPWYQYHSLDVIGFLLTCFAVIAALTVKCLLFMYRFFVKKEKKMK
DSQ  GGGAAGGTGTTGGTGTGGCCGATGGACTTTAGTCACTGGATGAATATAAAAATAATCCTTGATGAACTTGTACAGAGGGGCCATGAGGTCACTGTTCTGAAACCTTCGGCTTACTTTTTTCTTGATCCGAAAAAATCGTCTGACCTTAAGTTTGAAATTTTTTCTACATCTATCAGTAAAGATGAGCTGCAAAATCATTTCATAAAACTTTTGGATGTGTGGACTTATGAGTTGCCAAGA---GATACATGTTTGTCATATTCTCCTATCCTTCAAAATCTAGTTTATGAATTTTCTTATTTTTATCTAAGTATTTGTAAAGACGCTGTTTCAAACAAGCAGCTCATGACAAAACTACAGGAATCCAAGTTTGATGTTCTTTTCGCAGATCCTGTGGCTTCCTGTGGGGATCTGATAGCTGAACTGCTCCACATTCCTTTTCTGTACAGTCTTAGCTTCTCTCCAGGCCACAAACTTGAAAAGTCCATTGGAAAATTTATACTCCCTCCATCTTATGTGCCTGTAATTTTGTCGGGACTGGCTGGCAAAATGACATTCATAGACAGGGTAAAAAATATGATATGTATGCTTTATTTCGACTTTTGGTTCGAGAGACTTAGACACAAGGAATGGGACACGTTTTACAGTGAGATTTTGGGAAGGCCCACCACCGTAGATGAGACAATGAGCAAAGTAGAAATATGGCTTATTAGATCCTATTGGGATTTGAAATTTCCCCACCCAACATTACCAAATGTTGACTATATTGGAGGACTCCATTGCAAACCTGCTAAACCCTTGCCTAAGGATATGGAAGAATTTGTCCAGAGCTCTGGAGAGCACGGTGTGGTGGTGTTTTCTCTGGGGTCAATGGTCAGCAACATGACAGAAGAAAAGGCCAACGCAATTGCATGGGCCCTTGCCCAGATTCCACAAAAGGTTCTTTGGAAATTTGATGGC...............AAAACCCCAGCAACATTAGGACCCAATACC............---AGAGTCTACAAGTGGCTCCCGCAGAATGACCTCCTGGGTCACCCAAAAACCAAAGCCTTTGTAACTCATGGTGGAGCCAATGGCCTCTATGAGGCAATCTATCATGGAATCCCTATGATTGGCATTCCTCTGTTTGGAGATCAACCTGATAATATTGCCCACATGGTGGCCAAAGGAGCAGCTGTTTCATTGAATATCAGGACAATGTCAAAGTTAGATTTTCTCAGTGCACTGGAGGAAGTCATAGACAATCCGTTCTATAAAAAAAATGTTATGTTGTTGTCAACCATTCACCATGACCAGCCTATGAAGCCCCTGGACAGAGCTGTCTTCTGGATTGAGTTTATCATGCGCCACAAAGGGGCCAAGCACCTGAGACCACTTGGACATAACCTTCCCTGGTACCAGTACCACTCTCTGGATGTGATTGGATTCCTGCTCACCTGTTTTGCAGTCATTGCAGCTCTTACTGTAAAATGTCTCTTGTTCATGTACCGATTCTTTGTAAAGAAGGAAAAGAAAATGAAG
TRN  10010101100011000
NAM  UD13_HUMAN/29-526
ASQ  GKVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPEVNMHIK--EENFFTLTTYAISWTQDEFDRHVLGHTQLYFETEHFLKKFFRSMAMLN----NMSLVYHRSCVELLHNEALIRHLNATSFDVVLTDPVNLCAAVLAKYLSIPTVFFLRNIPCDLDFKGT-QCPNPSSYIPRLLTTNSDHMTFMQRVKNMLYPLALSYICHAFSAP-YASLASELFQREVSVVDILSHASVWLFRGDFVMDYPRPIMPNMVFIGGINCANRKPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTG.....TRPSNLANNT....-ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVK
DSQ  GGAAAGGTGTTGGTGGTGCCCATTGATGGCAGCCACTGGCTCAGCATGCGGGAGGTCTTGCGGGAGCTCCATGCCAGAGGCCACCAGGCAGTGGTCCTCACCCCAGAGGTGAATATGCACATCAAA------GAAGAGAACTTTTTCACCCTGACAACCTATGCCATTTCGTGGACCCAGGATGAATTTGATCGCCATGTGCTGGGCCACACTCAACTGTACTTTGAAACAGAACATTTTCTGAAGAAATTTTTCAGAAGTATGGCAATGTTGAAC------------AATATGTCTTTGGTCTATCATAGGTCTTGTGTGGAGCTACTACATAATGAGGCCCTGATCAGGCACCTGAATGCTACTTCCTTTGATGTGGTTTTAACAGACCCCGTTAACCTCTGCGCGGCAGTGCTGGCTAAGTACCTGTCGATTCCTACTGTGTTTTTTTTGAGGAACATTCCATGTGATTTAGACTTTAAGGGCACA---CAGTGTCCAAACCCTTCCTCCTATATTCCTAGATTACTAACAACCAATTCAGACCACATGACATTCATGCAAAGGGTCAAGAACATGCTCTACCCTCTGGCCCTGTCCTACATTTGCCATGCTTTTTCTGCTCCT---TATGCAAGCCTTGCCTCTGAGCTTTTTCAGAGAGAGGTGTCAGTGGTGGATATTCTCAGTCATGCATCTGTGTGGCTGTTCCGAGGGGACTTTGTGATGGACTACCCCAGGCCAATCATGCCCAACATGGTCTTCATTGGGGGCATCAACTGTGCCAACAGGAAGCCACTATCTCAGGAATTTGAAGCCTACATTAATGCTTCTGGAGAACATGGAATTGTGGTTTTCTCTTTGGGATCAATGGTCTCAGAAATTCCAGAGAAGAAAGCTATGGCAATTGCTGATGCTTTGGGCAAAATCCCTCAGACAGTCCTGTGGCGGTACACTGGA...............ACCCGACCATCGAATCTTGCGAACAACACG............---ATACTTGTTAAGTGGCTACCCCAAAACGATCTGCTTGGTCACCCGATGACCCGTGCCTTTATCACCCATGCTGGTTCCCATGGTGTTTATGAAAGCATATGCAATGGCGTTCCCATGGTGATGATGCCCTTGTTTGGTGATCAGATGGACAATGCAAAGCGCATGGAGACTAAGGGAGCTGGAGTGACCCTGAATGTTCTGGAAATGACTTCTGAAGATTTAGAAAATGCTCTAAAAGCAGTCATCAATGACAAAAGTTACAAGGAGAACATCATGCGCCTCTCCAGCCTTCACAAGGACCGCCCGGTGGAGCCGCTGGACCTGGCCGTGTTCTGGGTGGAGTTTGTGATGAGGCACAAGGGCGCGCCACACCTGCGCCCCGCAGCCCACGACCTCACCTGGTACCAGTACCATTCCTTGGACGTGATTGGTTTCCTCTTGGCCGTCGTGCTGACAGTGGCCTTCATCACCTTTAAATGTTGTGCTTATGGCTACCGGAAATGCTTGGGGAAAAAAGGGCGAGTTAAG
TRN  10010101100011000
NAM  UD12_RAT/28-525
ASQ  GKVLVFPMEGSHWLSMRDVVRELHARGHQAVVLAPEVTVHMK--GEDFFTLQTYAFPYTKEEYQREILGNAKKGFEPQHFVKTFFETMASIK----KFFDLYANSCAALLHNKTLIQQLNSSSFDVVLTDPVFPCGALLAKYLQIPAVFFLRSVPCGIDYEAT-QCPKPSSYIPNLLTMLSDHMTFLQRVKNMLYPLTLKYICHLSITP-YESLASELLQREMSLVEVLSHASVWLFRGDFVFDYPRPIMPNMVFIGGINCVIKKPLSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTLLWRYTG.....TRPSNLAKNT....-ILVKWLPQNDLLGHPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVK
DSQ  GGAAAGGTGCTGGTGTTTCCCATGGAGGGCAGCCACTGGCTGAGCATGAGGGATGTCGTGAGGGAGCTCCACGCCCGAGGTCACCAGGCTGTGGTCCTGGCTCCAGAGGTGACTGTGCACATGAAA------GGAGAGGACTTCTTCACCCTCCAAACCTATGCCTTTCCATATACCAAGGAAGAATATCAGCGGGAAATACTGGGCAACGCTAAGAAGGGCTTCGAACCACAACATTTTGTGAAGACTTTCTTTGAAACTATGGCATCTATAAAA------------AAGTTTTTCGATCTCTACGCAAATTCTTGTGCAGCTCTATTGCACAATAAGACCCTGATCCAGCAACTGAATTCCAGTTCCTTCGATGTGGTCTTAACAGACCCTGTTTTCCCCTGTGGAGCATTACTGGCCAAGTATCTACAGATTCCTGCTGTGTTTTTTCTGCGCTCTGTTCCCTGTGGCATAGACTATGAGGCTACA---CAATGTCCGAAACCTTCCTCTTATATTCCGAACCTACTCACAATGCTTTCTGACCACATGACCTTCCTGCAAAGGGTCAAGAACATGCTGTACCCTCTGACCTTGAAGTACATTTGCCATTTATCAATCACTCCC---TATGAAAGCCTGGCCTCTGAGCTTTTGCAGAGAGAAATGTCTTTAGTGGAGGTTCTCAGTCATGCATCTGTGTGGCTGTTCCGAGGGGACTTTGTGTTTGACTACCCGAGGCCCATCATGCCTAATATGGTCTTCATTGGAGGCATAAACTGTGTCATCAAGAAGCCCCTCTCTCAGGAATTTGAAGCCTATGTCAACGCCTCCGGAGAACATGGCATCGTGGTTTTCTCTTTGGGATCCATGGTCTCAGAGATTCCAGAGAAGAAAGCGATGGAAATCGCTGAGGCTTTGGGCAGAATTCCTCAGACGCTCCTGTGGCGCTACACCGGA...............ACTAGACCATCGAACCTTGCAAAGAACACT............---ATTCTTGTCAAATGGCTACCCCAAAACGATCTGCTTGGTCATCCAAAGGCTCGGGCGTTCATCACACACTCCGGTTCCCATGGTATTTATGAAGGAATATGCAATGGGGTTCCAATGGTGATGATGCCCTTGTTTGGTGATCAGATGGACAACGCCAAGCGCATGGAAACTCGGGGAGCTGGGGTGACCCTGAATGTCCTGGAAATGACTGCCGATGATTTGGAAAACGCCCTTAAAACTGTCATCAATAACAAGAGTTACAAGGAGAACATCATGCGCCTCTCCAGCCTTCACAAGGACCGTCCTATCGAGCCTCTGGACCTGGCTGTGTTCTGGGTGGAGTACGTGATGAGGCACAAGGGGGCGCCACACCTGCGCCCCGCCGCCCACGACCTCACCTGGTACCAGTACCACTCCTTGGACGTGATTGGCTTTCTCCTGGCCATCGTGTTGACGGTGGTCTTCATTGTCTATAAAAGTTGTGCCTATGGCTGCCGGAAATGCTTTGGGGGAAAGGGTCGAGTGAAG
TRN  10010101100011000
NAM  UD11_HUMAN/28-525
ASQ  GKILLIPVDGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIR--DGAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIK----KDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLEFEAT-QCPNPFSYVPRPLSSHSDHMTFLQRVKNMLIAFSQNFLCDVVYSP-YATLASEFLQREVTVQDLLSSASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTG.....TRPSNLANNT....-ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVK
DSQ  GGGAAGATACTGTTGATCCCAGTGGATGGCAGCCACTGGCTGAGCATGCTTGGGGCCATCCAGCAGCTGCAGCAGAGGGGACATGAAATAGTTGTCCTAGCACCTGACGCCTCGTTGTACATCAGA------GACGGAGCATTTTACACCTTGAAGACGTACCCTGTGCCATTCCAAAGGGAGGATGTGAAAGAGTCTTTTGTTAGTCTCGGGCATAATGTTTTTGAGAATGATTCTTTCCTGCAGCGTGTGATCAAAACATACAAGAAAATAAAA------------AAGGACTCTGCTATGCTTTTGTCTGGCTGTTCCCACTTACTGCACAACAAGGAGCTCATGGCCTCCCTGGCAGAAAGCAGCTTTGATGTCATGCTGACGGACCCTTTCCTTCCTTGCAGCCCCATCGTGGCCCAGTACCTGTCTCTGCCCACTGTATTCTTCTTGCATGCACTGCCATGCAGCCTGGAATTTGAGGCTACC---CAGTGCCCCAACCCATTCTCCTACGTGCCCAGGCCTCTCTCCTCTCATTCAGATCACATGACCTTCCTGCAGCGGGTGAAGAACATGCTCATTGCCTTTTCACAGAACTTTCTGTGCGACGTGGTTTATTCCCCG---TATGCAACCCTTGCCTCAGAATTCCTTCAGAGAGAGGTGACTGTCCAGGACCTATTGAGCTCTGCATCTGTCTGGCTGTTTAGAAGTGACTTTGTGAAGGATTACCCTAGGCCCATCATGCCCAATATGGTTTTTGTTGGTGGAATCAACTGCCTTCACCAAAATCCACTATCCCAGGAATTTGAAGCCTACATTAATGCTTCTGGAGAACATGGAATTGTGGTTTTCTCTTTGGGATCAATGGTCTCAGAAATTCCAGAGAAGAAAGCTATGGCAATTGCTGATGCTTTGGGCAAAATCCCTCAGACAGTCCTGTGGCGGTACACTGGA...............ACCCGACCATCGAATCTTGCGAACAACACG............---ATACTTGTTAAGTGGCTACCCCAAAACGATCTGCTTGGTCACCCGATGACCCGTGCCTTTATCACCCATGCTGGTTCCCATGGTGTTTATGAAAGCATATGCAATGGCGTTCCCATGGTGATGATGCCCTTGTTTGGTGATCAGATGGACAATGCAAAGCGCATGGAGACTAAGGGAGCTGGAGTGACCCTGAATGTTCTGGAAATGACTTCTGAAGATTTAGAAAATGCTCTAAAAGCAGTCATCAATGACAAAAGTTACAAGGAGAACATCATGCGCCTCTCCAGCCTTCACAAGGACCGCCCGGTGGAGCCGCTGGACCTGGCCGTGTTCTGGGTGGAGTTTGTGATGAGGCACAAGGGCGCGCCACACCTGCGCCCCGCAGCCCACGACCTCACCTGGTACCAGTACCATTCCTTGGACGTGATTGGTTTCCTCTTGGCCGTCGTGCTGACAGTGGCCTTCATCACCTTTAAATGTTGTGCTTATGGCTACCGGAAATGCTTGGGGAAAAAAGGGCGAGTTAAG
TRN  10010101100011000
NAM  UD12_HUMAN/26-522
ASQ  GKLVVVPMDGSHWFTMRSVVEKLILRGHEVVVVSARGELATG--KINELHSEDLFNFIYLEDLDREFKAFAHAQWKAQ-VRSIYSLLMGSYN----DIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIVAKYFSLPSVVFARGILCHYLEEGA-QCPAPLSYVPRILLGFSDDMTFKERVRNHIMHLEEHLLCHRFFKN-ALEIASEILQTPVTEYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHERKALPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTG.....TRPSNLANNT....-ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVK
DSQ  GGGAAGCTAGTGGTAGTGCCCATGGATGGGAGCCACTGGTTCACCATGAGGTCGGTGGTGGAGAAACTCATTCTCAGGGGGCATGAGGTGGTTGTAGTCAGTGCCAGAGGTGAGTTGGCAACTGGG------AAGATCAATGAATTGCACAGTGAAGACTTATTCAACTTCATATACCTGGAGGATCTGGACCGGGAGTTCAAGGCTTTTGCCCATGCTCAATGGAAAGCACAA---GTACGAAGTATATATTCTCTATTAATGGGTTCATACAAT------------GACATTTTTGACTTATTTTTTTCAAATTGCAGGAGTTTGTTTAAAGACAAAAAATTAGTAGAATACTTAAAGGAGAGTTCTTTTGATGCAGTGTTTCTCGATCCTTTTGATAACTGTGGCTTAATTGTTGCCAAATATTTCTCCCTCCCCTCCGTGGTCTTCGCCAGGGGAATACTTTGCCACTATCTTGAAGAAGGTGCA---CAGTGCCCTGCTCCTCTTTCCTATGTCCCCAGAATTCTCTTAGGGTTCTCAGATGACATGACTTTCAAGGAGAGAGTACGGAACCACATCATGCACTTGGAGGAACATTTATTATGCCACCGTTTTTTCAAAAAT---GCCCTAGAAATAGCCTCTGAAATTCTCCAAACACCTGTTACGGAGTATGATCTCTACAGCCACACATCAATTTGGTTGTTGCGAACGGACTTTGTTTTGGACTATCCCAAACCCGTGATGCCCAACATGATCTTCATTGGTGGTATCAACTGCCATGAGAGGAAAGCGTTGCCTATGGAATTTGAAGCCTACATTAATGCTTCTGGAGAACATGGAATTGTGGGTTTCTCTTTGGGATCAATGGTCTCAGAAATTCCAGAGAAGAAAGCTATGGCAATTGCTGATGCTTTGGGCAAAATCCCTCAGACAGTCCTGTGGCGGTACACTGGA...............ACCCGACCATGCAATCTTGCGAACAACACG............---ATACTTGTTAAGTGGCTACCCCAAAACGATCTGCTTGGTCACCCGATGACCAGTGCCTTTATCACCCATGCTGGTTCCCATGGTGTTTATGAAAGCATATGCAATGGCGTTCCCATGGTGATGATGCCCTTGTTTGGTGATCAGATGGACAATGCAAAGCGCATGGAGACTAAGGGAGCTGGAGTGACCATGAATGTTCTGGAAATGACTTCTGAAGAATTAGAAAATGCTCTAAAAGCAGTCATCAATGACAAAAGTTACAAGGAGAACATCATGCGCCTCTCCAGCCTTCACAAGGACCGCCCGGTGGAGCCGCTGGACCTGGCCGTGTTCTGGGTGGAGTTTGTTATGAGGCACAAGGGCGCGACACACCTGCGCCCCGCAGCCCACGACCTCACCTGGTACCAGTACCATTCCTTGGACGTGATTGGTTTCCTCTTGGCCGCCGTGCTGACAGTGGCCTTCATCACCTGTAAATGTTGTGCTTATGGCTACCGGAAATGCTTGGGGAAAAAAGGGCGAGTTAAG
TRN  10010101100011000
NAM  UD16_HUMAN/27-524
ASQ  DKLLVVPQDGSHWLSMKDIVEVLSDRGHEIVVVVPEVNLLLK--ESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNM----IVIGLYFINCQSLLQDRDTLNFFKESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEHTFS-RSPDPVSYIPRCYTKFSDHMTFSQRVANFLVNLLEPYLFYCLFSK-YEELASAVLKRDVDIITLYQKVSVWLLRYDFVLEYPRPVMPNMVFIGGINCKKRKDLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTG.....TRPSNLANNT....-ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVK
DSQ  GACAAGCTGCTGGTGGTCCCTCAGGACGGAAGCCACTGGCTTAGTATGAAGGATATAGTTGAGGTTCTCAGTGACCGGGGTCATGAGATTGTAGTGGTGGTGCCTGAAGTTAATTTGCTTTTGAAA------GAATCCAAATACTACACAAGAAAAATCTATCCAGTGCCGTATGACCAAGAAGAGCTGAAGAACCGTTACCAATCATTTGGAAACAATCACTTTGCTGAGCGATCATTCCTAACTGCTCCTCAGACAGAGTACAGGAATAACATG------------ATTGTTATTGGCCTGTACTTCATCAACTGCCAGAGCCTCCTGCAGGACAGGGACACCCTGAACTTCTTTAAGGAGAGCAAGTTTGATGCTCTTTTCACAGACCCAGCCTTACCCTGTGGGGTGATCCTGGCTGAGTATTTGGGCCTACCATCTGTGTACCTCTTCAGGGGTTTTCCGTGTTCCCTGGAGCATACATTCAGC---AGAAGCCCAGACCCTGTGTCCTACATTCCCAGGTGCTACACAAAGTTTTCAGACCACATGACTTTTTCCCAACGAGTGGCCAACTTCCTTGTTAATTTGTTGGAGCCCTATCTATTTTATTGTCTGTTTTCAAAG---TATGAAGAACTCGCATCAGCTGTCCTCAAGAGAGATGTGGATATAATCACCTTATATCAGAAGGTCTCTGTTTGGCTGTTAAGATATGACTTTGTGCTTGAATATCCTAGGCCGGTCATGCCCAACATGGTCTTCATTGGAGGTATCAACTGTAAGAAGAGGAAAGACTTGTCTCAGGAATTTGAAGCCTACATTAATGCTTCTGGAGAACATGGAATTGTGGTTTTCTCTTTGGGATCAATGGTCTCAGAAATTCCAGAGAAGAAAGCTATGGCAATTGCTGATGCTTTGGGCAAAATCCCTCAGACAGTCCTGTGGCGGTACACTGGA...............ACCCGACCATCGAATCTTGCGAACAACACG............---ATACTTGTTAAGTGGCTACCCCAAAACGATCTGCTTGGTCACCCGATGACCCGTGCCTTTATCACCCATGCTGGTTCCCATGGTGTTTATGAAAGCATATGCAATGGCGTTCCCATGGTGATGATGCCCTTGTTTGGTGATCAGATGGACAATGCAAAGCGCATGGAGACTAAGGGAGCTGGAGTGACCCTGAATGTTCTGGAAATGACTTCTGAAGATTTAGAAAATGCTCTAAAAGCAGTCATCAATGACAAAAGTTACAAGGAGAACATCATGCGCCTCTCCAGCCTTCACAAGGACCGCCCGGTGGAGCCGCTGGACCTGGCCGTGTTCTGGGTGGAGTTTGTGATGAGGCACAAGGGCGCGCCACACCTGCGCCCCGCAGCCCACGACCTCACCTGGTACCAGTACCATTCCTTGGACGTGATTGGTTTCCTCTTGGCCGTCGTGCTGACAGTGGCCTTCATCACCTTTAAATGTTGTGCTTATGGCTACCGGAAATGCTTGGGGAAAAAAGGGCGAGTTAAG
TRN  10010101100011000
//