EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00199 - Catalase)
FAM  PF00199
PID  Catalase
DES  Catalase
IPR  IPR011614
ANO  21
ALN  408
AID  0.513189
APH  (((((((CATA_MICLU/14-396:0.42997,CATA_LACSK/6-388:0.23611):0.07192,CATA_BACSU/6-390:0.16465):0.05140,(BCA_STRVL/7-391:0.26921,(CATA_HAEIN/16-400:0.13574,(CATA_PROMI/7-391:0.17646,CATA_BACFR/7-391:0.12805):0.03673):0.15086):0.08893):0.04410,(((CATA_PENJA/14-400:1.15553,CATA_BOVIN/27-412:0.05778):0.10648,CATA_DROME/26-411:0.14887):0.09416,((CATA_CANTR/5-390:0.09319,CATA_PICAN/8-404:0.19312):0.06662,CATA_YEAST/23-410:0.20563):0.25177):0.11768):0.19511,(((CATA1_GOSHI/18-401:0.08932,(CATA3_MAIZE/20-404:0.16494,CATA_IPOBA/18-401:0.12135):0.03663):0.03804,CATA1_LYCES/18-401:0.09997):0.33319,CATA_LISSE/8-391:0.32151):0.07253):0.27877,CATE_ECOLI/81-469:0.19093):0.11490,CATE_BACPF/28-416:0.06024,CATE_BACSU/31-419:0.07294);
ATP  (((((((CATA_MICLU/14-396,CATA_LACSK/6-388),CATA_BACSU/6-390),(BCA_STRVL/7-391,(CATA_HAEIN/16-400,(CATA_PROMI/7-391,CATA_BACFR/7-391)))),(((CATA_PENJA/14-400,CATA_BOVIN/27-412),CATA_DROME/26-411),((CATA_CANTR/5-390,CATA_PICAN/8-404),CATA_YEAST/23-410))),(((CATA1_GOSHI/18-401,(CATA3_MAIZE/20-404,CATA_IPOBA/18-401)),CATA1_LYCES/18-401),CATA_LISSE/8-391)),CATE_ECOLI/81-469),CATE_BACPF/28-416,CATE_BACSU/31-419);
ATL  6.68236
DNO  18
DLN  1224
DID  0.546337
DPH  ((CATE_BACSU/31-419:0.14002,CATE_BACPF/28-416:0.18696):0.11216,((((CATA_IPOBA/18-401:0.13254,(CATA1_LYCES/18-401:0.15569,CATA1_GOSHI/18-401:0.12982):0.10695):0.07342,CATA3_MAIZE/20-404:0.19587):0.24372,(((CATA_DROME/26-411:0.19005,(CATA_PICAN/8-404:0.16774,(CATA_YEAST/23-410:0.31239,CATA_CANTR/5-390:0.12268):0.08595):0.25070):0.07966,(BCA_STRVL/7-391:0.17293,CATA_MICLU/14-396:0.28702):0.12146):0.08221,((CATA_BACFR/7-391:0.19535,CATA_HAEIN/16-400:0.21885):0.16545,(CATA_BACSU/6-390:0.20725,CATA_LACSK/6-388:0.28045):0.04713):0.09762):0.11034):0.06455,CATA_LISSE/8-391:0.36576):0.18245,CATE_ECOLI/81-469:0.19573);
DTP  ((CATE_BACSU/31-419,CATE_BACPF/28-416),((((CATA_IPOBA/18-401,(CATA1_LYCES/18-401,CATA1_GOSHI/18-401)),CATA3_MAIZE/20-404),(((CATA_DROME/26-411,(CATA_PICAN/8-404,(CATA_YEAST/23-410,CATA_CANTR/5-390))),(BCA_STRVL/7-391,CATA_MICLU/14-396)),((CATA_BACFR/7-391,CATA_HAEIN/16-400),(CATA_BACSU/6-390,CATA_LACSK/6-388)))),CATA_LISSE/8-391),CATE_ECOLI/81-469);
DTL  5.48087
RID  0.52914
RPH  ((((((CATA_BACSU/6-390:0.17123,(CATA_MICLU/14-396:0.43671,CATA_LACSK/6-388:0.22720):0.06878):0.04163,(BCA_STRVL/7-391:0.26446,(CATA_HAEIN/16-400:0.13745,CATA_BACFR/7-391:0.14063):0.15293):0.09181):0.04916,(((CATA_CANTR/5-390:0.08684,CATA_PICAN/8-404:0.20143):0.06335,CATA_YEAST/23-410:0.20783):0.23021,CATA_DROME/26-411:0.20662):0.14315):0.19424,(((CATA1_GOSHI/18-401:0.08914,(CATA3_MAIZE/20-404:0.16471,CATA_IPOBA/18-401:0.12149):0.03667):0.03782,CATA1_LYCES/18-401:0.10013):0.33420,CATA_LISSE/8-391:0.32204):0.07270):0.27884,CATE_ECOLI/81-469:0.18672):0.11880,CATE_BACPF/28-416:0.06004,CATE_BACSU/31-419:0.07314);
RTP  ((((((CATA_BACSU/6-390,(CATA_MICLU/14-396,CATA_LACSK/6-388)),(BCA_STRVL/7-391,(CATA_HAEIN/16-400,CATA_BACFR/7-391))),(((CATA_CANTR/5-390,CATA_PICAN/8-404),CATA_YEAST/23-410),CATA_DROME/26-411)),(((CATA1_GOSHI/18-401,(CATA3_MAIZE/20-404,CATA_IPOBA/18-401)),CATA1_LYCES/18-401),CATA_LISSE/8-391)),CATE_ECOLI/81-469),CATE_BACPF/28-416,CATE_BACSU/31-419);
RTL  5.1287
LNK  BCA_STRVL/7-391:P33569:X74791
LNK  CATA1_GOSHI/18-401:P17598:X52135
LNK  CATA1_LYCES/18-401:P30264:M93719
LNK  CATA3_MAIZE/20-404:P18123:L05934
LNK  CATA_BACFR/7-391:P45737:U18676
LNK  CATA_BACSU/6-390:P26901:Z82044
LNK  CATA_BOVIN/27-412:P00432:
LNK  CATA_CANTR/5-390:P07820:X06660
LNK  CATA_DROME/26-411:P17336:U00145
LNK  CATA_HAEIN/16-400:P44390:U32774
LNK  CATA_IPOBA/18-401:P07145:X05549
LNK  CATA_LACSK/6-388:P30265:M84015
LNK  CATA_LISSE/8-391:P24168:M75944
LNK  CATA_MICLU/14-396:P29422:AJ438208
LNK  CATA_PENJA/14-400:P11934:
LNK  CATA_PICAN/8-404:P30263:X56501
LNK  CATA_PROMI/7-391:P42321:
LNK  CATA_YEAST/23-410:P15202:X13028
LNK  CATE_BACPF/28-416:P30266:L02551
LNK  CATE_BACSU/31-419:P42234:Z99123
LNK  CATE_ECOLI/81-469:P21179:M55161
AMK  xxxxxxxxxxxxxxxxxxxx..........xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxx.xxxxxxxxxxxxxx..xxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..............................xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  CATE_ECOLI/81-469
ASQ  TTNQGVRIADDQNSLRAGSR..........GPTLLEDFILREKITHFDHERIPERIVHARGSAAHGYFQPYKSLSDITKADFLSDPNKITPVFVRFSTVQGGAGSADTVRDIRGFATKFYTEEGIFDLVGNNTPIFFIQDAHKFPDFVHAVKPEPHWAIPQGQSAHDTFWDYVSLQPE..TLHNVMWAMSD.RGIPRSYRTMEGFGIHTFRLINAEGKATFVRFHWKPLAGKASLV.WDEAQKLTGRDPDFHRRELWEAIEAGDFPEYELGFQLIPEEDEFKFDFDLLDPTKLIPEELVPVQRVGKMVLNRNPDNFFAENEQAAFHPGHIVPGLDFTNDPLLQGRLFSYTDTQISRLGGPNFHEIPINRPT.CPYHNFQ.RDGMHRMGIDTNP-..ANYEPNSINDNW
DSQ  ACCACTAATCAGGGCGTGCGCATCGCCGACGATCAAAACTCACTGCGTGCCGGTAGCCGT..............................GGTCCAACGCTGCTGGAAGATTTTATTCTGCGCGAGAAAATCACCCACTTTGACCATGAGCGCATTCCGGAACGTATTGTTCATGCACGCGGATCAGCCGCTCACGGTTATTTCCAGCCATATAAAAGCTTAAGCGATATTACCAAAGCGGATTTCCTCTCAGATCCGAACAAAATCACCCCAGTATTTGTACGTTTCTCTACCGTTCAGGGTGGTGCTGGCTCTGCTGATACCGTGCGTGATATCCGTGGCTTTGCCACCAAGTTCTATACCGAAGAGGGTATTTTTGACCTCGTTGGCAATAACACGCCAATCTTCTTTATCCAGGATGCGCATAAATTCCCCGATTTTGTTCATGCGGTAAAACCAGAACCGCACTGGGCAATTCCACAAGGGCAAAGTGCCCACGATACTTTCTGGGATTATGTTTCTCTGCAACCTGAA......ACTCTGCACAACGTGATGTGGGCGATGTCGGAT...CGCGGCATCCCCCGCAGTTACCGCACCATGGAAGGCTTCGGTATTCACACCTTCCGCCTGATTAATGCCGAAGGGAAGGCAACGTTTGTACGTTTCCACTGGAAACCACTGGCAGGTAAAGCCTCACTCGTT...TGGGATGAAGCACAAAAACTCACCGGACGTGACCCGGACTTCCACCGCCGCGAGTTGTGGGAAGCCATTGAAGCAGGCGATTTTCCGGAATACGAACTGGGCTTCCAGTTGATTCCTGAAGAAGATGAATTCAAGTTCGACTTCGATCTTCTCGATCCAACCAAACTTATCCCGGAAGAACTGGTGCCCGTTCAGCGTGTCGGCAAAATGGTGCTCAATCGCAACCCGGATAACTTCTTTGCTGAAAACGAACAGGCGGCTTTCCATCCTGGGCATATCGTGCCGGGACTGGACTTCACCAACGATCCGCTGTTGCAGGGACGTTTGTTCTCCTATACCGATACACAAATCAGTCGTCTTGGTGGGCCGAATTTCCATGAGATTCCGATTAACCGTCCGACC...TGCCCTTACCATAATTTCCAG...CGTGACGGCATGCATCGCATGGGGATCGACACTAACCCG---......GCGAATTACGAACCGAACTCGATTAACGATAACTGG
TRN  11011101101011000
NAM  CATE_BACSU/31-419
ASQ  TTNQGLRVSEDEHSLKAGVR..........GPTLMEDFHFREKMTHFDHERIPERVVHARGFGVHGFFQVYEPMTEYTRAKFLQDPSVKTPVFVRFSTVAGSKGSADTVRDARGFATKFYTEEGNYDLVGNNIPVFFIQDAIKFPDLVHAFKPEPHNEMPQAATAHDTFWDFVANNPE..SAHMVMWTMSD.RGIPRSYRMMEGFGVHTFRFVNEQGKARFVKFHWKPVLGVHSLV.WDEAQKIAGKDPDFHRRDLWETIENGGKVEYELGVQMIDEEDEFKFDFDILDPTKLWPEELVPVKIIGKMTLNRNQDNVFAETEQVAFHPGNVVPGIDFTNDPLLQGRLFPYTDTQLIRLGGPNFHEIPINRPV.CPFHNNQ.YDGYHRMTINKGP-..VAYHKNSLQNND
DSQ  ACGACAAACCAAGGCTTGCGAGTGTCAGAGGATGAGCACTCGTTAAAAGCCGGGGTTCGC..............................GGCCCGACGCTGATGGAGGATTTTCATTTCCGGGAGAAAATGACGCACTTTGACCATGAGAGGATTCCGGAGCGCGTTGTGCATGCGCGCGGATTTGGCGTGCATGGCTTTTTTCAGGTTTACGAACCAATGACGGAATACACACGGGCCAAATTTCTTCAGGACCCTTCGGTGAAGACACCGGTATTTGTCCGTTTTTCTACGGTTGCGGGTTCTAAAGGCTCCGCAGACACGGTGCGGGATGCCAGAGGCTTTGCGACAAAATTTTATACTGAAGAAGGAAACTATGACCTTGTGGGAAATAACATTCCGGTGTTTTTCATTCAGGACGCAATCAAATTTCCGGATTTGGTTCACGCGTTTAAGCCTGAGCCACACAATGAAATGCCTCAGGCTGCGACTGCTCACGATACATTTTGGGATTTTGTCGCCAATAACCCTGAG......TCTGCCCACATGGTGATGTGGACGATGTCTGAC...AGAGGCATCCCGCGCAGCTACAGAATGATGGAAGGCTTCGGCGTTCACACGTTCCGTTTTGTCAATGAACAAGGAAAGGCACGTTTCGTGAAATTTCACTGGAAGCCGGTGCTCGGCGTGCATTCTCTCGTA...TGGGATGAAGCGCAAAAAATTGCCGGGAAAGATCCAGATTTCCACCGCCGTGACCTGTGGGAAACAATTGAAAACGGCGGCAAGGTTGAATACGAGCTCGGCGTGCAGATGATTGATGAGGAAGATGAATTCAAGTTTGATTTTGATATTCTTGACCCAACTAAGCTGTGGCCGGAAGAGCTTGTGCCGGTGAAGATCATTGGAAAAATGACGCTGAACCGCAATCAGGATAATGTGTTTGCGGAAACAGAACAAGTCGCATTCCACCCGGGAAATGTCGTGCCGGGCATCGATTTTACCAATGACCCGCTATTGCAGGGGCGGCTTTTCCCTTATACGGATACACAGCTCATCCGTCTTGGCGGCCCGAACTTCCATGAGATTCCGATTAACCGGCCGGTC...TGTCCATTCCATAACAACCAA...TACGACGGCTATCACCGGATGACGATCAATAAGGGACCT---......GTCGCTTATCATAAAAACTCACTGCAAAACAATGAT
TRN  10010101100011000
NAM  CATE_BACPF/28-416
ASQ  TTNQGLKVSEDEFSLKAGER..........GPTLMEDFHFREKMTHFDHERIPERIVHARGFAAHGEFQVYDSMKEFTKAKFLQDPSVKTPVFVRFSTVAGSKGSAETVRDARGFATKFYTEEGNYDLVGNNIPVFFIQDAIKFPDLVHALKPEPHNEIPQAQSAHDTFWDFIANNQE..SAHMVMWAMSD.RSIPRSFRMMEGFGVHTFRFVNEEGKAHFVKFHWKPVLGIHSLV.WDEAQKIAGKDPDFHRRDLWESIENGDYPEYELGVQLISEEDEFNFDFDVLDPTKIWPEEEVPVKIIGKMTLNRNVDNVFAETEQVAFHPGHVVPGIDFTNDPLLQGRLFSYTDTQLIRLGGPNFHELPINRPV.CPFHNNQ.RDGYGRQTINKGQ-..VSYHKNSLAANT
DSQ  ACAACCAATCAAGGATTAAAAGTTTCTGAAGATGAATTTTCCCTTAAGGCTGGCGAACGT..............................GGGCCAACTTTAATGGAAGACTTTCATTTCCGCGAAAAAATGACTCATTTTGACCATGAACGGATTCCTGAGAGGATTGTTCATGCCCGTGGATTTGCAGCACACGGTGAGTTCCAAGTATATGATTCTATGAAAGAGTTTACAAAGGCAAAGTTTTTGCAAGATCCATCTGTTAAAACACCTGTTTTTGTCCGCTTCTCTACAGTAGCAGGTTCAAAAGGTTCTGCTGAGACAGTTCGAGATGCTCGTGGATTTGCGACTAAATTTTATACTGAAGAAGGAAACTACGATTTAGTGGGTAATAATATTCCTGTTTTCTTTATCCAAGATGCAATTAAGTTTCCAGATTTAGTTCATGCCCTTAAGCCAGAACCGCATAATGAAATCCCACAAGCACAATCAGCTCATGATACATTTTGGGACTTCATTGCAAACAATCAGGAA......TCTGCCCATATGGTCATGTGGGCAATGTCAGAC...CGATCCATCCCCCGCAGCTTCCGAATGATGGAAGGCTTCGGAGTCCACACTTTCCGATTTGTTAATGAAGAAGGTAAAGCTCATTTTGTTAAGTTTCATTGGAAGCCGGTGCTTGGTATTCATTCGCTTGTG...TGGGATGAAGCACAGAAAATTGCTGGTAAAGACCCCGATTTCCACCGTCGTGACTTATGGGAATCGATTGAAAATGGAGATTATCCTGAATACGAACTAGGTGTTCAGCTTATTAGCGAAGAGGATGAATTTAACTTCGACTTTGATGTACTCGATCCGACAAAGATATGGCCAGAAGAAGAAGTACCTGTGAAAATCATCGGGAAAATGACATTAAACCGTAATGTAGATAATGTATTTGCTGAAACGGAGCAAGTTGCCTTCCATCCAGGACATGTAGTACCGGGAATTGATTTTACAAATGATCCTCTCTTGCAAGGTAGATTGTTCTCCTATACGGATACACAGCTGATCCGCTTAGGAGGTCCTAACTTTCATGAGCTGCCGATTAATAGACCGGTA...TGCCCTTTCCATAATAACCAG...CGAGATGGGTATGGGCGTCAAACGATTAATAAAGGACAG---......GTAAGTTATCATAAAAACTCTTTAGCAGCTAATACA
TRN  10010101100011000
NAM  CATA_LISSE/8-391
ASQ  TTNQGVPIGDNQNSMTAGLK..........GPTLLEDYVLIEKLAHFDRERVPERVVHARGAGAHGKFVTKKSMKKYTKAQFLQEEGTETEVFARFSTVIHGQHSPETLRDPRGFSVKFYTEEGNYDFVGNNLPVFFIRDAIKFPDVIHSLKPDPRTNIQD----GNRYWDFFSLTPE..ATTMITYLFSD.EGTPASYREIRGSSVHAFKWINEEGKTVYVKLRWVPKAGIVNLS.TDQAAQIQAKEFNHASRDLYEAIENGDYPEWDLYVQVLDPKDLDNYDFNPLDATKDWFEDVFPYEHVGTMTLNRNPDNIFAETESVGFNPGVLVPGMLPSEDRVLQGRLFSYSDTQRHRVG-PNYLQLPINSPK.TPVDNNQ.RDGQMPFKQQTSS-..INYEPNSYDTEP
DSQ  ACGACGAATCAAGGAGTGCCGATTGGGGACAACCAAAATTCGATGACAGCGGGATTAAAA..............................GGACCAACTTTGTTAGAAGATTATGTGTTAATTGAGAAATTGGCGCATTTTGATAGAGAACGTGTTCCAGAACGTGTGGTGCATGCTCGTGGTGCTGGTGCGCACGGCAAATTTGTAACGAAAAAAAGCATGAAAAAATATACGAAAGCACAATTTTTACAAGAAGAAGGAACAGAGACAGAGGTTTTTGCGCGTTTTTCTACAGTAATCCATGGTCAACATTCACCAGAAACGCTTCGTGATCCACGTGGTTTTTCGGTTAAATTTTATACGGAAGAAGGTAACTATGACTTTGTCGGTAACAACTTACCTGTATTCTTTATCCGTGATGCTATCAAGTTTCCTGACGTAATTCACTCCTTGAAGCCAGATCCACGTACTAACATTCAAGAT------------GGCAATCGTTACTGGGACTTCTTTAGTTTAACTCCGGAA......GCGACGACGATGATTACTTATTTATTTAGCGAT...GAGGGGACTCCGGCATCTTACCGCGAAATTCGTGGTTCAAGCGTACATGCCTTTAAATGGATAAACGAAGAAGGTAAGACTGTTTATGTAAAACTACGCTGGGTTCCAAAAGCAGGAATCGTCAATCTTTCA...ACTGATCAAGCAGCACAAATTCAAGCAAAAGAATTTAACCATGCTAGTCGCGATTTGTATGAAGCAATTGAGAATGGTGATTATCCAGAGTGGGATTTATATGTGCAAGTGCTAGATCCAAAAGACTTGGATAATTACGACTTCAATCCGCTTGATGCAACCAAAGACTGGTTTGAAGATGTATTTCCATACGAGCATGTTGGAACAATGACATTAAATCGTAATCCGGATAATATTTTTGCTGAAACAGAATCAGTTGGCTTTAATCCAGGTGTGCTTGTGCCGGGGATGTTACCTTCTGAGGACCGTGTACTACAGGGGCGATTGTTCTCTTACTCTGATACGCAAAGACACCGCGTTGGA---CCTAACTACTTACAATTACCAATCAACAGCCCAAAA...ACTCCTGTTGATAACAACCAA...CGTGATGGACAGATGCCGTTTAAACAGCAAACAAGTTCG---......ATTAATTATGAACCAAATAGTTATGATACAGAACCA
TRN  10010101110011000
NAM  CATA_IPOBA/18-401
ASQ  TTNSGAPVWNNTCALTVGSR..........GPILLEDYHLVEKIQNFTRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMYTRGGNWDLVGNNFPVFFIRDGTQFPDVIHAFKPNPKSHIQE----NWRILDYLSHLPE..SLNTFAWFYDD.VGIPTDYRHMEGFGVHTFTMINKEGKANYVKFHWKPTCGVKCLL.EEEAIRIGGENHSHATQDLYESIAAGNYPEWKLYIQVMDPDHEDRFDFDPLDTTKIWPEELIPLQPVGRMVLNKNIDNFFAENEMLAMDPAHIVPGIYFSDDKMLQARVFAYADTHRHRLG-PNYMLLPVNAPK.CAHHNNS.YDGYMNFVHRDEE-..VDYFPSKFDNTR
DSQ  ACTACCAACTCCGGAGCTCCGGTATGGAACAACACCTGCGCACTCACCGTCGGCAGCAGA..............................GGACCAATTCTGCTAGAAGATTATCACTTGGTGGAGAAAATTCAAAACTTCACTCGTGAAAGGATCCCAGAACGAGTGGTGCATGCCAGGGGTGCAAGTGCCAAGGGCTTCTTTGAGGTCACTCATGACATTACACACCTCACCTGCGCCGACTTCCTCCGTGCCCCCGGCGTTCAGACACCTCTCATCGTCCGCTTCTCCACTGTCATCCATGAGCGTGGTAGCCCCGAAACTATCAGAGATCCCCGTGGTTTTGCCGTCAAGATGTACACCCGTGGAGGAAACTGGGATTTGGTGGGCAACAATTTCCCGGTGTTCTTTATCCGGGACGGAACGCAGTTCCCGGACGTGATCCACGCGTTCAAGCCAAACCCGAAATCCCACATCCAGGAG------------AACTGGAGAATCCTGGATTACTTATCCCATCTCCCGGAG......AGTCTCAACACCTTCGCCTGGTTCTACGACGAT...GTCGGTATCCCCACCGATTACCGCCACATGGAAGGCTTCGGCGTCCACACTTTCACCATGATCAACAAGGAAGGCAAGGCCAATTATGTAAAATTCCACTGGAAACCCACCTGCGGCGTCAAATGTCTGCTG...GAAGAGGAGGCGATTAGGATCGGCGGCGAGAATCACAGCCACGCCACCCAGGATTTATACGAGTCCATCGCCGCCGGGAATTACCCGGAGTGGAAGCTTTATATCCAAGTGATGGACCCGGATCACGAGGACCGGTTCGATTTTGACCCGCTGGACACGACCAAGATCTGGCCGGAAGAGTTGATTCCTCTGCAGCCGGTGGGGAGAATGGTGTTGAACAAGAATATTGATAATTTCTTTGCGGAGAATGAGATGTTGGCGATGGACCCGGCGCATATTGTCCCCGGAATATACTTCTCCGATGATAAGATGCTCCAGGCTCGAGTCTTTGCCTACGCCGACACTCACCGCCACCGCCTTGGC---CCCAACTATATGCTGCTTCCGGTTAATGCCCCCAAG...TGCGCTCATCACAACAATAGC...TATGATGGTTACATGAACTTTGTCCACAGGGATGAAGAG---......GTTGATTACTTTCCCTCGAAGTTTGATAACACACGT
TRN  10010101100011010
NAM  CATA1_LYCES/18-401
ASQ  TTNAGGPVYNNVSSLTVGPR..........GPVLLEDYYLIEKLATFDREKIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGAQTPVICRFSTVVHERGSPESIRDIRGFAVKFYTREGNFDLVGNNVPVFFNRDAKSFPDTIRALKPNPKSHIQE----NWRILDFFSFLPE..SLHTFAFFYDD.VCLPTDYRHMEGFGVHAYQLINKEGKAHYVKFHWKPTCGVKCMS.EEEAIRVGGTNHSHATKDLYDSIAAGNYPEWKLFIQTMDPEDVDKFDFDPLDVTKTWPEDLLPLIPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIG-PNYMQLPVNAPK.CGHHNNH.RDGAMNMTHRDEE-..VDYLPSRFDPCR
DSQ  ACAACAAATGCTGGTGGTCCTGTGTACAACAATGTTTCTTCCTTGACTGTTGGACCTAGA..............................GGGCCTGTTCTGCTTGAGGATTACTATCTAATTGAGAAGCTCGCGACATTTGATCGCGAGAAGATACCTGAACGTGTTGTTCATGCTAGAGGTGCTAGTGCTAAGGGATTCTTTGAAGTTACTCATGACATTTCTCATCTTACTTGTGCTGATTTTCTCCGAGCTCCTGGCGCTCAAACGCCTGTTATTTGTCGATTCTCTACTGTTGTCCATGAACGTGGAAGCCCCGAGTCTATCAGGGACATTCGTGGTTTTGCTGTCAAGTTCTACACCAGAGAGGGTAACTTTGATCTTGTTGGAAACAATGTCCCCGTGTTCTTTAATCGTGATGCTAAGTCGTTCCCTGACACGATTCGTGCATTGAAACCAAATCCAAAGTCACACATTCAGGAG------------AACTGGAGGATACTTGATTTCTTCTCGTTCCTTCCTGAG......AGTTTGCATACATTCGCCTTCTTCTACGATGAT...GTTTGTCTCCCAACGGATTACAGACACATGGAAGGTTTTGGCGTTCACGCGTATCAATTGATTAACAAAGAGGGGAAAGCACATTATGTGAAGTTCCACTGGAAGCCAACTTGTGGTGTGAAATGTATGTCT...GAGGAAGAAGCTATTAGAGTCGGTGGTACTAATCATAGCCACGCGACCAAGGATCTTTACGATTCAATTGCTGCTGGAAACTATCCTGAGTGGAAGCTTTTTATCCAAACAATGGACCCCGAGGATGTAGACAAGTTCGATTTTGATCCTCTGGATGTAACCAAGACATGGCCTGAGGATCTCTTGCCGTTGATCCCAGTTGGTCGATTGGTGTTGAACAGGAACATTGATAACTTCTTCGCAGAGAATGAACAACTCGCGTTTAACCCTGGACATATTGTCCCTGGTATTTACTATTCCGAGGATAAGCTTCTCCAGACTAGGATATTCGCGTATGCTGATACTCAGAGACACCGTATTGGA---CCAAACTATATGCAGCTCCCAGTTAATGCTCCCAAG...TGTGGTCATCACAACAATCAT...CGCGATGGTGCTATGAACATGACACATCGCGATGAAGAG---......GTGGATTATTTGCCCTCGAGGTTTGATCCTTGTCGT
TRN  10010101100011001
NAM  CATA1_GOSHI/18-401
ASQ  TTNSGAPVWNNNSSLTVGPR..........GQYLLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQE----NWRILDFFSHHPE..SLHMFTFLFDD.LGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL.EDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLFIQTIDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLG-PNYLQLPANAPK.CAHHNNH.HEGFMNFMHRDEE-..INYFPSRYDPVR
DSQ  ACTACCAATTCTGGCGCTCCAGTTTGGAATAACAATTCATCTCTCACTGTTGGACCCAGA..............................GGTCAATATCTCCTTGAGGACTATCATCTGGTGGAAAAGCTTGCCAACTTTGACAGGGAGCGGATTCCAGAACGTGTTGTCCATGCTAGGGGAGCAAGCGCAAAGGGTTTCTTCGAGGTTACCCATGACATTTCTCACCTTACATGTGCTGATTTTCTGCGAGCACCTGGAGTTCAAACCCCTGTTATCGTGCGATTTTCAACCGTCATCCATGAGCGTGGAAGCCCTGAAACCCTCAGGGATCCTCGTGGTTTTGCAGTGAAGTTCTACACCCGAGAGGGTAATTTTGATCTTGTGGGAAACAATTTCCCAGTCTTCTTTATTCGTGATGGAATGAAATTCCCTGATATGGTCCATGCTCTTAAGCCCAACCCTAAGTCCCATATTCAGGAG------------AATTGGAGGATCCTTGATTTCTTCTCACACCATCCTGAG......AGCTTGCATATGTTTACTTTCCTCTTTGATGAT...TTGGGTGTTCCACAAGATTACAGACACATGGAAGGTTCTGGTGTAAACACATACACTCTGATTAACAAGGCTGGCAAAGCACACTATGTGAAATTCCACTGGAAGCCCACTTGTGGGGTCAAATGCTTGCTG...GAAGATGAGGCAATCAAGGTTGGAGGAGCTAATCACAGCCATGCCACTCAGGATCTCTATGACTCAATTGCTGCTGGCAACTATCCTGAGTGGAAGCTCTTCATCCAGACAATTGATCCTGACCATGAAGATAAATTTGACTTTGACCCTCTTGATGTGACTAAGACCTGGCCTGAGGACATCTTGCCCCTGCAGCCTGTTGGCCGCTTGGTTTTGAATAAGAACATTGACAACTTCTTCGCCGAAAATGAACAGCTTGCATTTTGCCCTGCCATTGTGGTTCCTGGAATCTACTACTCAGATGATAAGTTGCTCCAGACTCGTATATTCTCCTACTCTGATACCCAGAGGCACAGACTTGGG---CCAAACTATCTGCAACTCCCAGCCAATGCTCCCAAG...TGTGCTCATCACAACAATCAC...CACGAAGGTTTTATGAATTTCATGCACAGGGATGAGGAG---......ATAAATTACTTCCCTTCAAGGTACGATCCTGTTCGT
TRN  10010101100011001
NAM  CATA3_MAIZE/20-404
ASQ  TTNAGAPVWNDNEALTVGPR..........GPILLEDYHLIEKVAHFARERIPERVVHARGASAKGFFECTHDVTSLTCADFLRAPGVRTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPRSHVQE----YWRVFDFLSHLPE..SLHTFFFLFDD.VGVPSDYRHMEGFGVNTYTFVSAAGKAQYVKFHWKPTCGVRCILtDEEAALVGGRNHSHATQDLYDSIAAGSFPEWTLYVQVMDPDTEEQYDFDPLDDTKTWPEDLLPLRPVGRLVLDRNVDNFFNENEQLAFGPGLVVPGIYYSDDKMLQCRVFAYADTQRYRLG-PNYLMLPVNAPR.CAHHNNH.YDGAMNFMHRDEE-..VDYYPSRHAPLR
DSQ  ACGACGAACGCTGGCGCTCCTGTGTGGAACGACAACGAGGCGCTGACTGTGGGGCCTCGC..............................GGTCCCATCCTGCTGGAGGACTACCACCTGATCGAGAAGGTGGCGCACTTCGCGCGCGAGCGCATCCCGGAGCGCGTGGTGCACGCGCGCGGCGCGTCCGCCAAGGGCTTCTTCGAGTGCACCCACGACGTGACGTCGCTGACGTGCGCCGACTTCCTGCGCGCGCCCGGCGTGCGGACGCCCGTGATCGTGCGCTTCTCGACGGTGATCCACGAGCGGGGGTCCCCGGAGACGATCCGCGACCCGCGCGGGTTCGCCGTGAAGTTCTACACCCGCGAGGGCAACTGGGACCTGCTGGGCAACAACTTCCCCGTCTTCTTCATCCGCGACGGCATCAAGTTCCCCGACGTGATCCACGCGTTCAAGCCCAACCCGCGGTCGCACGTGCAGGAG------------TACTGGCGGGTGTTCGACTTCCTGTCGCACCTCCCCGAG......AGCCTGCACACCTTCTTCTTCCTCTTCGACGAC...GTGGGCGTGCCGTCCGACTACCGCCACATGGAAGGGTTCGGCGTGAACACGTACACGTTCGTGAGCGCGGCGGGGAAGGCGCAGTACGTGAAGTTCCACTGGAAGCCGACGTGCGGCGTGCGGTGCATCCTGacgGACGAGGAGGCGGCGCTGGTCGGGGGACGGAACCACAGCCACGCGACGCAGGACCTGTACGACTCCATCGCGGCGGGGAGCTTCCCGGAGTGGACGCTGTACGTGCAGGTGATGGACCCGGACACGGAGGAGCAGTACGACTTCGACCCGCTGGACGACACCAAGACGTGGCCGGAGGACCTGCTGCCGCTCCGCCCCGTGGGGAGGCTGGTGCTGGACAGGAACGTGGACAACTTCTTCAACGAGAACGAGCAGCTGGCGTTCGGGCCGGGGCTGGTGGTGCCAGGGATCTACTACTCGGACGACAAGATGCTGCAGTGCCGGGTGTTCGCCTACGCCGACACGCAGCGCTACAGGCTGGGT---CCCAACTACCTGATGCTGCCCGTCAACGCGCCGCGC...TGCGCGCACCACAACAACCAC...TACGACGGCGCCATGAACTTCATGCACCGCGACGAGGAG---......GTGGACTACTACCCGTCCAGGCACGCGCCGCTGCGG
TRN  10010101100011011
NAM  CATA_BACFR/7-391
ASQ  TAANGRPIADNQNSQTAGPR..........GPIMLQDPWLIEKLAHFDREVIPERRMHAKGSGAYGTFTVTHDITKYTRAAIFSQVGKQTECFVRFSTVAGERGAADAERDIRGFAMKFYTEEGNWDLVGNNTPVFFLRDPLKFPDLNHAVKRDPRNNMRS----ANNNWDFWTLLPE..ALHQVTITMSP.RGIPASYRHMHGFGSHTYSFLNAENKRIWVKFHLKTMQGIKNLT.DQEAEAIIAKDRESHQRDLYESIERGDFPKWKFQIQLMTEEEADNYRINPFDLTKVWPHKDFPLQDVGILELNRNPENYFAEVEQSAFNPMNIVEGIGFSPDKMLQGRLFSYGDAQRYRLG-VNSEQIPVNKPR.CPFHAFH.RDGAMRVDGNYGSA..KGYEPNSYGEWQ
DSQ  ACAGCAGCTAATGGTCGTCCTATCGCCGACAACCAAAACAGCCAGACAGCAGGACCTCGC..............................GGGCCTATTATGTTACAAGACCCATGGTTGATTGAAAAACTTGCTCATTTCGACCGTGAAGTTATCCCTGAACGCCGTATGCATGCCAAAGGCTCCGGAGCTTACGGTACATTTACCGTCACACATGATATCACCAAGTACACACGAGCAGCTATTTTCAGTCAAGTAGGCAAGCAAACAGAATGTTTTGTACGTTTCTCCACTGTAGCAGGAGAACGCGGAGCTGCTGATGCAGAACGCGATATCCGGGGATTTGCCATGAAGTTTTATACAGAAGAAGGAAACTGGGATTTGGTAGGTAACAATACTCCCGTCTTCTTCTTACGCGACCCGCTAAAATTTCCTGATTTAAATCATGCTGTAAAACGCGATCCACGCAACAACATGCGTAGC------------GCTAACAATAATTGGGATTTCTGGACCCTGTTACCCGAG......GCTCTTCATCAGGTAACTATCACTATGAGTCCG...CGTGGCATTCCGGCTTCCTATCGCCACATGCACGGATTCGGCAGCCATACTTACAGTTTCTTAAACGCAGAAAACAAACGAATTTGGGTTAAGTTTCATCTAAAGACTATGCAGGGCATTAAAAACCTGACT...GATCAGGAAGCTGAAGCAATCATCGCCAAAGATCGTGAATCGCATCAACGTGACCTATACGAAAGTATCGAACGGGGTGATTTCCCAAAATGGAAGTTCCAGATTCAGTTGATGACTGAAGAAGAAGCAGATAACTATCGTATCAATCCGTTCGACCTTACCAAGGTTTGGCCACACAAAGATTTCCCATTGCAAGATGTAGGTATTCTTGAATTGAACCGTAATCCGGAAAACTATTTTGCAGAAGTAGAACAATCGGCTTTCAATCCGATGAATATTGTTGAAGGTATCGGCTTCTCTCCCGACAAGATGTTGCAAGGACGATTATTTTCTTATGGTGATGCACAACGCTACCGATTGGGT---GTAAACTCAGAGCAGATACCGGTAAACAAGCCACGT...TGTCCGTTCCACGCCTTCCAT...CGTGACGGAGCAATGCGAGTGGACGGAAACTATGGTTCAGCC......AAAGGTTATGAACCGAATAGTTATGGCGAATGGCAA
TRN  10010101100011000
NAM  CATA_HAEIN/16-400
ASQ  TMGNGAPVADNQNSLTAGPR..........GPLLAQDLWLNEKLADFVREVIPERRMHAKGSGAFGTFTVTHDITKYTRAKIFSEVGKKTEMFARFTTVAGERGAADAERDIRGFALKFYTEEGNWDLVGNNTPVFFLRDPRKFPDLNKAVKRDPRTNMRS----ATNNWDFWTLLPE..ALHQVTVVMSD.RGIPASYRHMHGFGSHTYSFWNEAGERFWVKFHFRTQQGIKNLT.DAEAAEIIANDRESHQRDLYEAIERGDFPKWTLFVQIMPEADAEKVPYHPFDLTKVWSKKDYPLIEVGEFELNRNPENFFADVEQSAFAPSNLVPGIGASPDRMLQARLFNYADAQRYRLG-VNYRQIPVNRPR.CPVHSNQ.RDGQGRVDGNYGSL..PHYEPNSFSQWQ
DSQ  ACAATGGGTAACGGTGCACCCGTTGCTGATAACCAAAACAGCTTAACAGCTGGTCCGCGT..............................GGTCCATTACTTGCACAAGATTTATGGCTTAACGAAAAATTAGCTGATTTCGTACGTGAAGTGATCCCAGAGCGTCGTATGCACGCTAAAGGTTCTGGCGCATTTGGTACTTTTACTGTGACACACGACATTACTAAATATACTCGTGCAAAAATTTTTAGTGAAGTGGGTAAAAAAACGGAAATGTTCGCACGTTTTACCACCGTGGCAGGCGAACGTGGTGCAGCAGATGCTGAGCGTGATATTCGTGGTTTTGCATTAAAATTCTATACTGAAGAAGGTAACTGGGATTTAGTAGGTAACAATACGCCAGTATTCTTCTTACGTGATCCACGTAAATTCCCAGATTTAAATAAAGCAGTAAAACGTGATCCTCGCACTAATATGCGTTCA------------GCAACTAATAACTGGGATTTCTGGACATTATTACCAGAA......GCATTACACCAAGTCACTGTTGTAATGAGTGAT...CGTGGTATTCCAGCAAGTTATCGTCATATGCACGGTTTCGGTTCTCACACTTATAGTTTCTGGAACGAAGCGGGCGAACGTTTTTGGGTAAAATTCCACTTCCGTACTCAACAAGGCATTAAAAATTTAACA...GATGCTGAAGCAGCCGAAATTATTGCAAATGACCGTGAAAGCCATCAACGTGATTTATATGAAGCGATTGAACGTGGCGATTTCCCTAAATGGACATTATTTGTACAAATTATGCCGGAAGCAGATGCGGAAAAAGTGCCTTATCACCCATTCGACTTAACTAAAGTATGGTCGAAAAAAGACTATCCATTAATTGAAGTCGGCGAGTTTGAATTAAACCGTAACCCAGAAAACTTCTTCGCTGATGTAGAACAATCTGCGTTTGCACCAAGTAACTTGGTTCCGGGTATTGGCGCAAGCCCTGACAGAATGTTACAAGCCCGTTTATTTAACTATGCGGATGCACAACGTTACCGTTTAGGT---GTGAACTACCGTCAAATTCCAGTAAACCGTCCACGT...TGCCCTGTTCATAGCAACCAA...CGTGATGGTCAAGGTCGTGTAGATGGTAACTACGGTAGCTTG......CCACACTACGAGCCAAACAGCTTCAGCCAATGGCAA
TRN  10010101110011000
NAM  CATA_PROMI/7-391
ASQ  TTAAGAPVVDNNNVITAGPR..........GPMLLQDVWFLEKLAHFDREVIPERRMHAKGSGAFGTFTVTHDITKYTRAKIFSEVGKKTEMFARFSTVAGERGAADAERDIRGFALKFYTEEGNWDMVGNNTPVFYLRDPLKFPDLNHIVKRDPRTNMRN----MAYKWDFFSHLPE..SLHQLTIDMSD.RGLPLSYRFVHGFGSHTYSFINKDNERFWVKFHFRCQQGIKNLM.DDEAEALVGKDRESSQRDLFEAIERGDYPRWKLQIQIMPEKEASTVPYNPFDLTKVWPHADYPLMDVGYFELNRNPDNYFSDVEQAAFSPANIVPGISFSPDKMLQGRLFSYGDAHRYRLG-VNHHQIPVNAPK.CPFHNYH.RDGAMRVDGNSGNG..ITYEPNSGGVFQ
NAM  CATA_DROME/26-411
ASQ  TTGNGAPIGIKDASQTVGPR..........GPILLQDVNFLDEMSHFDRERIPERVVHAKGAGAFGYFEVTHDITQYCAAKIFDKVKKRTPLAVRFSTVGGESGSADTARDPRGFAVKFYTEDGVWDLVGNNTPVFFIRDPILFPSFIHTQKRNPQTHLKD----PDMFWDFLTLRPE..SAHQVCILFSD.RGTPDGYCHMNGYGSHTFKLINAKGEPIYAKFHFKTDQGIKNLD.VKTADQLASTDPDYSIRDLYNRIKTCKFPSWTMYIQVMTYEQAKKFKYNPFDVTKVWSQKEYPLIPVGKMVLDRNPKNYFAEVEQIAFSPAHLVPGVEPSPDKMLHGRLFSYSDTHRHRLG-PNYLQIPVNCPYkVKIENFQ.RDGAMNVTDNQDGA..PNYFPNSFNGPQ
DSQ  ACCACCGGCAATGGAGCACCCATTGGTATCAAGGATGCCTCCCAGACGGTTGGTCCGCGA..............................GGACCTATCCTGCTGCAGGATGTGAACTTCCTGGATGAGATGTCGCACTTCGACAGGGAGCGGATTCCAGAGCGTGTCGTGCACGCCAAGGGAGCTGGTGCTTTTGGTTACTTTGAGGTGACCCACGACATCACCCAGTATTGTGCCGCCAAGATTTTCGACAAGGTCAAGAAGCGCACTCCACTGGCCGTGCGATTCTCCACCGTGGGTGGTGAGAGCGGATCTGCGGACACCGCCCGCGATCCTCGAGGATTTGCCGTCAAGTTCTACACTGAGGATGGCGTTTGGGATTTGGTTGGCAACAACACGCCGGTCTTCTTCATTCGCGACCCGATCCTATTCCCCAGCTTCATTCACACCCAGAAGCGCAACCCGCAGACGCATCTGAAGGAT------------CCGGACATGTTCTGGGACTTCCTCACCCTGCGACCGGAG......TCCGCTCACCAGGTGTGCATCCTGTTCAGCGAT...CGCGGCACCCCCGACGGTTACTGCCACATGAACGGCTATGGCTCGCACACCTTCAAATTGATCAACGCCAAGGGCGAGCCCATCTATGCCAAGTTCCACTTCAAGACGGACCAGGGCATCAAGAATCTGGAC...GTGAAGACCGCCGATCAGTTGGCTAGCACTGATCCGGATTACAGCATTCGCGATCTGTACAACAGGATCAAGACCTGCAAGTTCCCCAGTTGGACGATGTACATTCAGGTCATGACCTACGAGCAGGCCAAGAAGTTCAAGTACAACCCCTTCGATGTCACCAAGGTCTGGTCGCAGAAGGAGTACCCTCTGATTCCTGTGGGCAAAATGGTGCTGGATCGCAATCCCAAGAACTACTTTGCTGAGGTGGAGCAGATCGCCTTCAGTCCCGCTCACCTGGTGCCCGGCGTCGAGCCCTCTCCGGACAAGATGCTGCATGGTCGTCTGTTCTCCTACTCGGACACCCATCGCCATCGCCTGGGA---CCGAACTACTTGCAGATCCCGGTGAACTGCCCGTACaagGTGAAGATTGAGAACTTCCAG...CGGGATGGAGCCATGAATGTGACGGACAACCAGGATGGTGCC......CCCAACTACTTCCCCAACTCGTTCAACGGTCCCCAG
TRN  10010101100011011
NAM  CATA_BOVIN/27-412
ASQ  TTGGGNPVGDKLNSLTVGPR..........GPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDALLFPSFIHSQKRNPQTHLKD----PDMVWDFWSLRPE..SLHQVSFLFSD.RGIPDGHRHMDGYGSHTFKLVNADGEAVYCKFHYKTDQGIKNLS.VEDAARLAHEDPDYGLRDLFNAIATGNYPSWTLYIQVMTFSEAEIFPFNPFDLTKVWPHGDYPLIPVGKLVLNRNPVNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFAYPDTHRHRLG-PNYLQIPVNCPYrARVANYQ.RDGPMCMMDNQGGA..PNYYPNSFSAPE
NAM  BCA_STRVL/7-391
ASQ  TTEAGAPVADNQNSETAGVG..........GPVLVQDQLLLEKLAHFNRERIPERVVHARGAGAYGTFTLTRDVSRWTRAAFLSEVGKRTETFLRFSTVAGSLGAADAVRDPRGWALKFYTEEGNYDLVGNNTPVFFIKDAIKFPDFIHTQKRDPYTGSQE----ADNVWDFWGLSPE..STHQVTWLFGD.RGIPASYRHMNGYGSHTYQWNNEAGEVFWVKYHFKTDQGIKNLT.QDEANRLAGEDPDSHQRDLREAIERGDFPTWTVQVQIMPAADAAGYRFNPFDLTKVWPHEDYPPVEIGTLELNRNPENIFAEVEQSIFSPAHFVPGIGPSPDKMLQGRLFAYGDAHRYRVG-INADHLPVNRPH.ATEARTHsRDGFLYDGRHKG-A..KNYEPNSFGGPV
DSQ  ACCACGGAGGCCGGCGCGCCGGTCGCCGACAACCAGAACAGCGAGACGGCGGGCGTAGGC..............................GGTCCGGTCCTCGTCCAGGACCAGCTGCTGCTCGAGAAGCTCGCCCACTTCAACCGTGAGCGCATCCCGGAGCGCGTGGTCCACGCGCGCGGTGCGGGCGCCTACGGCACCTTCACGCTCACCCGTGACGTCTCGCGGTGGACGCGGGCCGCCTTCCTCTCCGAGGTCGGCAAGCGGACCGAGACCTTCCTGCGCTTCTCCACCGTCGCGGGCAGCCTCGGCGCGGCCGACGCGGTGCGCGATCCGCGCGGCTGGGCGCTGAAGTTCTACACCGAGGAGGGCAACTACGACCTCGTCGGCAACAACACCCCGGTGTTCTTCATCAAGGACGCCATCAAGTTCCCCGACTTCATCCACACCCAGAAGCGCGACCCGTACACGGGCTCGCAGGAG------------GCGGACAACGTCTGGGACTTCTGGGGCCTGTCGCCGGAG......TCGACCCACCAGGTGACCTGGCTGTTCGGCGAC...CGCGGCATCCCGGCCTCGTACCGCCACATGAACGGCTACGGCTCGCACACGTACCAGTGGAACAACGAGGCCGGCGAGGTCTTCTGGGTCAAGTACCACTTCAAGACCGACCAGGGGATCAAGAACCTCACG...CAGGACGAGGCCAACCGGCTGGCCGGCGAGGACCCGGACTCGCACCAGCGCGACCTGCGCGAGGCCATCGAGCGCGGCGACTTCCCGACCTGGACCGTGCAGGTCCAGATCATGCCCGCGGCCGACGCGGCGGGCTACCGCTTCAACCCCTTCGACCTCACCAAGGTCTGGCCGCACGAGGACTACCCGCCGGTCGAGATCGGCACCCTGGAGCTCAACCGCAACCCGGAGAACATCTTCGCCGAGGTCGAGCAGAGCATCTTCTCCCCGGCGCACTTCGTGCCCGGCATCGGGCCGTCCCCGGACAAGATGCTCCAGGGCCGTCTCTTCGCGTACGGCGACGCGCACCGCTACCGCGTCGGC---ATCAACGCCGACCACCTGCCGGTGAACCGCCCGCAC...GCCACCGAGGCGCGGACGCACtccCGTGACGGCTTCCTCTACGACGGCCGCCACAAGGGC---GCG......AAGAACTACGAGCCCAACTCCTTCGGCGGACCGGTC
TRN  11011111101111111
NAM  CATA_BACSU/6-390
ASQ  TTSWGAPVGDNQNSMTAGSR..........GPTLIQDVHLLEKLAHFNRERVPERVVHAKGAGAHGYFEVTNDVTKYTKAAFLSEVGKRTPLFIRFSTVAGELGSADTVRDPRGFAVKFYTEEGNYDIVGNNTPVFFIRDAIKFPDFIHTQKRDPKTHLKN----PTAVWDFWSLSPE..SLHQVTILMSD.RGIPATLRHMHGFGSHTFKWTNAEGEGVWIKYHFKTEQGVKNLD.VNTAAKIAGENPDYHTEDLFNAIENGDYPAWKLYVQIMPLEDANTYRFDPFDVTKVWSQKDYPLIEVGRMVLDRNPENYFAEVEQATFSPGTLVPGIDVSPDKMLQGRLFAYHDAHRYRVG-ANHQALPINRAR.NKVNNYQ.RDGQMRFGDNGGGS..VYYEPNSFGGPK
DSQ  ACAACTAGCTGGGGCGCTCCGGTTGGAGATAATCAAAACTCAATGACTGCCGGTTCTCGC..............................GGACCAACTTTAATTCAAGATGTACATTTACTCGAAAAATTGGCCCATTTCAACCGAGAACGTGTTCCTGAACGTGTTGTTCACGCCAAAGGAGCAGGCGCACACGGATATTTTGAAGTGACAAACGACGTAACAAAATACACGAAAGCCGCTTTCCTTTCTGAAGTCGGCAAACGCACACCGTTGTTCATCCGTTTCTCAACAGTTGCCGGTGAACTTGGCTCTGCTGACACAGTTCGCGACCCGCGCGGATTTGCTGTTAAATTTTATACTGAAGAAGGAAACTACGACATCGTCGGCAACAATACGCCTGTATTCTTTATCCGCGATGCGATTAAGTTCCCTGATTTCATCCATACACAAAAAAGAGATCCAAAAACACACCTGAAAAAC------------CCTACGGCTGTATGGGATTTCTGGTCACTTTCACCAGAG......TCACTGCACCAAGTGACAATCCTGATGTCTGAC...CGCGGAATTCCTGCGACACTTCGCCACATGCACGGCTTCGGAAGCCATACATTCAAATGGACAAATGCCGAAGGCGAAGGCGTATGGATTAAATATCACTTTAAAACAGAACAAGGCGTGAAAAACCTTGAT...GTCAATACGGCAGCAAAAATTGCCGGTGAAAACCCTGATTACCATACAGAAGACCTTTTCAACGCAATCGAAAACGGTGATTATCCTGCATGGAAACTATATGTGCAAATCATGCCTTTAGAAGATGCAAATACGTACCGTTTCGATCCGTTTGATGTCACAAAAGTTTGGTCTCAAAAAGACTACCCGTTAATCGAGGTCGGACGCATGGTTCTAGACAGAAATCCGGAAAACTACTTTGCAGAGGTAGAACAAGCGACATTTTCACCTGGAACCCTCGTGCCTGGTATTGATGTTTCACCGGATAAAATGCTTCAAGGTCGACTTTTTGCTTATCATGATGCACACCGCTACCGTGTCGGT---GCAAACCATCAAGCGCTGCCAATCAACCGCGCACGC...AACAAAGTAAACAATTATCAG...CGTGATGGGCAAATGCGTTTTGGTGATAACGGCGGCGGATCT......GTGTATTACGAGCCTAACAGCTTCGGCGGTCCAAAA
TRN  10010101100011000
NAM  CATA_LACSK/6-388
ASQ  TTNEGQPWADNQHSQTAGQR..........GPVLIQDYQLLEKLAHFNRERIPERVVHAKGAGAKGYFKVTKDMSAYTKAAVFSGVGKKTPLITRFSQVAGEAGYPDTYRDVRGFAVKFYTEEGNYDIVGNNTPVFFVNDPLKFPDFIHSQKRDPRTHARS----QDMQWDFWSLSPE..SVHQVTILMSD.RGIPASYRMMHGFGSHTFKWVNAQGEQFWVKYHFKTNQGIHNLS.NELADELAGKDTDYLQNDLFDAIETGDYPSWTVAVQLVPYEDGLNYPQDIFDVTKVISQKDYPLIEIGQMVLDENPTNNFEDIQELAFSPANLVPGIEASPDKLLQGRLFGYKDAERYRLG-ANYEQLPVNRPK.VPVHNYE.RDGAMAQNQATG--..VNYEPNSQDGPT
DSQ  ACGACTAACGAGGGGCAACCGTGGGCGGACAATCAACATTCGCAAACTGCCGGCCAACGC..............................GGCCCCGTCTTAATCCAAGATTATCAATTACTCGAAAAACTCGCCCACTTTAACCGCGAACGCATCCCTGAACGGGTGGTGCATGCCAAAGGCGCTGGCGCTAAAGGCTATTTCAAGGTTACCAAGGACATGAGCGCATATACCAAAGCCGCTGTTTTCAGTGGCGTCGGCAAAAAAACACCGCTTATCACTCGTTTTTCTCAAGTCGCTGGTGAAGCCGGCTATCCCGATACATACCGCGATGTCCGCGGTTTCGCCGTTAAATTCTATACGGAAGAAGGCAATTACGATATTGTCGGCAATAACACGCCGGTCTTCTTCGTCAATGATCCACTAAAATTCCCCGATTTCATCCACTCTCAAAAACGTGATCCCCGGACACATGCCCGTAGC------------CAAGATATGCAATGGGATTTCTGGTCCCTGTCACCCGAA......TCTGTCCACCAAGTCACGATTCTCATGAGTGAT...CGCGGGATTCCTGCTAGTTACCGGATGATGCACGGCTTTGGTAGCCACACCTTCAAATGGGTTAACGCACAAGGTGAACAATTCTGGGTTAAATACCATTTCAAGACGAACCAAGGTATTCACAATCTCAGC...AACGAACTCGCCGATGAACTCGCTGGTAAGGATACTGATTACCTTCAAAATGATTTATTCGACGCAATTGAAACCGGCGATTATCCAAGTTGGACGGTTGCCGTCCAACTCGTCCCTTATGAAGATGGCTTGAATTATCCCCAAGATATTTTTGATGTTACTAAAGTTATTTCACAAAAGGATTATCCATTAATCGAAATCGGTCAAATGGTCCTCGATGAAAATCCAACGAATAACTTCGAAGATATCCAAGAACTGGCCTTCTCACCGGCTAACTTAGTCCCTGGGATTGAAGCATCACCCGACAAATTACTTCAAGGTCGACTATTTGGCTATAAGGATGCTGAACGTTACCGGCTTGGT---GCCAACTACGAGCAACTCCCTGTCAACCGACCAAAA...GTCCCCGTTCATAATTACGAA...CGTGACGGTGCGATGGCCCAAAATCAAGCAACTGGC------......GTTAACTACGAACCCAACAGTCAAGATGGACCCACT
TRN  11011101101011000
NAM  CATA_YEAST/23-410
ASQ  TNSTGNPINEPFVTQRIGEH..........GPLLLQDYNLIDSLAHFNRENIPQRNPHAHGSGAFGYFEVTDDITDICGSAMFSKIGKRTKCLTRFSTVGGDKGSADTVRDPRGFATKFYTEEGNLDWVYNNTPVFFIRDPSKFPHFIHTQKRNPQTNLRD----ADMFWDFLTTPENqvAIHQVMILFSD.RGTPANYRSMHGYSGHTYKWSNKNGDWHYVQVHIKTDQGIKNLT.IEEATKIAGSNPDYCQQDLFEAIQNGNYPSWTVYIQTMTERDAKKLPFSVFDLTKVWPQGQFPLRRVGKIVLNENPLNFFAQVEQAAFAPSTTVPYQEASADPVLQARLFSYADAHRYRLG-PNFHQIPVNCPYaSKFFNPAiRDGPMNVNGNFGSE..PTYLAN-DKSYT
DSQ  ACAAACTCCACTGGTAATCCAATCAATGAACCATTTGTCACCCAACGTATTGGGGAACAT..............................GGCCCTTTGCTTTTGCAAGATTATAACTTAATTGATTCTTTGGCTCATTTCAACAGGGAAAATATTCCTCAAAGGAATCCACATGCTCATGGTTCTGGTGCCTTCGGCTATTTTGAAGTAACCGATGACATTACTGATATCTGCGGGTCTGCTATGTTTAGTAAAATTGGGAAAAGAACGAAATGTCTAACAAGATTTTCGACTGTGGGTGGTGATAAAGGTAGTGCCGACACGGTTCGTGATCCAAGGGGGTTTGCCACCAAATTCTACACTGAAGAAGGTAATTTAGATTGGGTCTACAATAATACACCGGTATTCTTTATCAGAGACCCTTCCAAGTTCCCTCACTTTATCCACACACAGAAGAGAAACCCACAAACCAACCTAAGGGAT------------GCTGACATGTTTTGGGATTTCCTCACCACTCCTGAAAATcaggtgGCCATTCATCAAGTAATGATCCTTTTTTCAGAC...CGTGGTACCCCTGCCAACTACCGTAGTATGCATGGTTATTCTGGTCATACCTATAAATGGTCCAATAAAAACGGAGATTGGCATTATGTGCAAGTTCATATCAAAACCGATCAAGGAATAAAGAATTTGACC...ATAGAAGAGGCTACCAAAATTGCGGGATCCAATCCAGATTACTGCCAGCAGGATTTATTTGAGGCTATTCAGAATGGAAACTATCCTTCCTGGACAGTTTATATTCAAACAATGACCGAACGCGATGCCAAAAAATTACCATTTTCAGTCTTTGATTTGACTAAAGTATGGCCTCAGGGGCAATTCCCTTTACGGCGTGTGGGTAAGATTGTTTTGAACGAGAATCCACTGAACTTCTTCGCACAGGTGGAACAAGCTGCCTTCGCCCCCAGTACCACGGTTCCTTACCAAGAAGCAAGCGCTGATCCAGTATTACAGGCCCGTTTGTTTTCATATGCGGATGCTCATAGATACAGGCTAGGT---CCTAACTTCCATCAAATACCCGTAAACTGTCCATATgcaTCTAAATTTTTCAATCCCGCTatcAGAGATGGACCGATGAATGTTAACGGCAACTTCGGCTCAGAA......CCTACATATTTGGCCAAC---GATAAATCGTACACG
TRN  10010101100011000
NAM  CATA_PICAN/8-404
ASQ  TTSQGCPVSDPFTTQRIPLDstgykyappiGPLLLQDFKLIDTLSHFDRERIPERVVHAKGAGAYGVFEVTDDITDVCSAKFLDTVGKKTRIFTRFSTVGGEKGSADTARDPRGFATKFYTEDGNLDLVYNNTPIFFIRDPIKFPHFIHTQKRNPATNLKD----PNMFWDYLTANDE..SLHQVMYLFSN.RGTPASYRTMNGYSGHTYKWYNSKGEWVYVQVHFIANQGVHNLL.DEEAGRLAGEDPDHSTRDLWEAIEKGDYPSWECYIQTMTLEQSKKLPFSVFDLTKVWPHKDFPLRHFGRFTLNENPKNYYAETEQIAFSPSHTVPGMEPSNDPVLQSRLFSYPDTHRHRLG-PNYHQIPVNCPLkSGSFNPInRDGPMCVDGNLGGT..PNYANAYNCPIQ
DSQ  ACTACTTCGCAAGGTTGTCCCGTGTCGGATCCCTTCACCACCCAACGGATCCCTCTGGATtccacgggctacaagtatgcccctccaattGGTCCATTGCTCTTGCAGGACTTCAAGCTCATTGACACACTCTCCCACTTTGACAGAGAAAGAATTCCAGAGAGAGTGGTGCACGCCAAGGGTGCCGGAGCTTACGGTGTGTTTGAAGTGACCGACGACATTACCGATGTTTGCAGTGCCAAGTTCCTCGACACTGTTGGTAAGAAGACAAGAATTTTCACCAGATTCTCCACTGTGGGTGGAGAAAAAGGTTCTGCAGACACAGCCAGGGACCCAAGGGGATTTGCTACCAAATTCTACACAGAAGACGGAAACTTGGACCTTGTGTACAACAACACGCCGATCTTCTTCATCAGGGACCCAATTAAGTTCCCCCACTTTATTCACACGCAGAAGAGAAACCCGGCCACCAACTTGAAGGAC------------CCAAACATGTTCTGGGACTACCTGACGGCCAATGACGAG......TCTTTGCACCAAGTCATGTATTTATTCTCCAAC...AGAGGTACGCCTGCCTCGTACAGAACCATGAACGGCTACTCTGGCCACACCTACAAATGGTACAATTCCAAGGGCGAGTGGGTGTATGTGCAGGTCCACTTCATTGCCAACCAAGGCGTGCACAATCTGCTC...GACGAGGAAGCTGGAAGGCTGGCTGGAGAAGATCCAGACCACTCCACCAGAGACTTGTGGGAAGCAATTGAGAAAGGAGATTATCCATCGTGGGAGTGCTACATCCAGACCATGACCCTTGAGCAGTCCAAGAAGCTGCCATTCTCTGTGTTTGACTTGACCAAGGTCTGGCCACACAAGGACTTCCCGCTGAGACACTTTGGCAGATTCACTCTTAATGAGAATCCTAAGAATTACTATGCTGAAACGGAGCAGATTGCCTTCTCTCCTTCGCACACCGTTCCTGGAATGGAGCCTTCGAACGACCCTGTCTTGCAATCGAGACTGTTTTCGTACCCAGACACGCACAGACACAGACTTGGA---CCTAACTACCACCAGATCCCTGTCAACTGTCCACTGaaaTCGGGCTCGTTCAATCCTATCaacAGAGACGGTCCTATGTGTGTTGATGGCAACTTGGGAGGCACG......CCGAACTACGCAAACGCTTACAACTGTCCTATTCAG
TRN  10010101100011010
NAM  CATA_CANTR/5-390
ASQ  TNSNGQPIPEPFATQRVGQH..........GPLLLQDFNLIDSLAHFDRERIPERVVHAKGSGAYGVFEVTDDITDVCAAKFLDTVGKKTRIFTRFSTVGGELGSADTARDPRGFATKFYTEEGNLDLVYNNTPVFFIRDPSKFPHFIHTQKRNPETHLKD----ANMFWDYLTTNEE..SVHQVMVLFSD.RGTPASYREMNGYSGHTYKWSNNKGEWFYVQVHFISDQGIKTLT.NEEAGSLAGSNPDYAQEDLFKNIAAGNYPSWTCYIQTMTEAQAKEAEFSVFDLTKVWPHGKYPMRRFGKFTLNENPKNYFAEVEQAAFSPAHTVPHMEPSADPVLQSRLFSYADTHRHRLG-TNYTQIPVNCPVtGAVFNPHmRDGAMNVNGNLGNH..PNYLAS-DKPIE
DSQ  ACAAACTCAAACGGTCAACCTATCCCTGAACCTTTCGCCACTCAAAGAGTTGGTCAACAC..............................GGTCCTTTGTTGTTGCAAGACTTCAACTTGATTGACTCCTTGGCCCACTTCGACAGAGAAAGAATCCCAGAAAGAGTCGTTCACGCTAAGGGTTCAGGTGCTTACGGTGTCTTTGAAGTCACCGATGACATCACCGACGTTTGTGCCGCAAAGTTCTTGGACACTGTCGGTAAAAAGACCAGAATTTTCACTAGATTTTCCACCGTCGGTGGTGAACTGGGTTCCGCTGACACCGCCAGAGACCCAAGAGGTTTTGCTACCAAGTTTTACACCGAAGAAGGTAACTTGGACTTGGTTTACAACAACACCCCTGTCTTTTTCATTAGAGACCCTTCCAAGTTCCCTCACTTCATCCACACCCAAAAGAGAAACCCGGAAACTCACTTGAAGGAC------------GCCAACATGTTCTGGGACTACTTGACCACCAACGAAGAA......TCCGTCCACCAAGTTATGGTTTTGTTCTCCGAC...AGAGGTACCCCAGCTTCCTACAGAGAAATGAATGGTTACTCTGGCCACACCTACAAGTGGTCCAACAACAAGGGTGAATGGTTCTACGTCCAGGTCCATTTCATCAGTGACCAAGGTATCAAGACCTTGACC...AACGAAGAAGCTGGCTCCTTGGCTGGTTCCAACCCAGACTATGCTCAAGAAGATTTGTTCAAAAACATTGCTGCTGGTAACTACCCATCCTGGACCTGTTACATCCAAACCATGACTGAAGCTCAAGCTAAAGAAGCTGAATTCTCCGTCTTTGACTTGACCAAGGTCTGGCCACACGGAAAGTACCCAATGAGAAGATTTGGTAAGTTTACTTTGAACGAAAACCCAAAGAACTACTTTGCCGAAGTTGAACAAGCTGCTTTCTCCCCAGCCCACACCGTTCCACACATGGAACCATCTGCTGACCCAGTCTTGCAATCCAGATTGTTCTCTTATGCTGATACTCACAGACACAGATTGGGT---ACCAACTACACCCAAATCCCAGTCAACTGCCCAGTCactGGTGCTGTTTTCAACCCACACatgAGAGACGGTGCCATGAATGTCAATGGTAACTTGGGCAACCAT......CCAAACTACTTGGCCTCT---GACAAACCAATTGAA
TRN  10010101100011001
NAM  CATA_MICLU/14-396
ASQ  TRQNGAPAVSDRQSLTVGSE..........GPIVLHDTHLLETHQHFNRMNIPERRPHAKGSGAFGEFEVTEDVSKYTKALVFQP-GTKTETLLRFSTVAGELGSPDTWRDVRGFALRFYTEEGNYDLVGNNTPIFFLRDPMKFTHFIRSQKRLPDSGLRD----ATMQWDFWTNNPE..SAHQVTYLMGP.RGLPRTWREMNGYGSHTYLWVNAQGEKHWVKYHFISQQGVHNLS.NDEATKIAGENADFHRQDLFESIAKGDHPKWDLYIQAIPYEEGKTYRFNPFDLTKTISQKDYPRIKVGTLTLNRNPENHFAQIESAAFSPSNTVPGIGLSPDRMLLGRAFAYHDAQLYRVG-AHVNQLPVNRPK.NAVHNYA.FEGQMWYDHTGDR-..STYVPNSNGDSW
DSQ  ACCCGCCAGAACGGCGCCCCGGCCGTCAGCGACCGCCAGTCCCTGACCGTGGGCAGCGAG..............................GGTCCCATCGTCCTGCACGACACCCACCTGCTGGAGACCCACCAGCACTTCAACCGCATGAACATCCCGGAGCGCCGCCCGCACGCCAAGGGCTCGGGCGCGTTCGGCGAGTTCGAGGTGACCGAGGACGTGTCGAAGTACACCAAGGCCCTCGTGTTCCAGCCG---GGCACGAAGACCGAGACCCTCCTGCGCTTCTCCACCGTGGCCGGCGAGCTCGGCTCCCCGGACACCTGGCGCGACGTGCGCGGCTTCGCGCTGCGCTTCTACACCGAGGAGGGCAACTACGACCTCGTCGGCAACAACACCCCGATCTTCTTCCTGCGCGACCCCATGAAGTTCACCCACTTCATCCGCTCGCAGAAGCGCCTGCCGGACTCCGGCCTGCGCGAT------------GCCACCATGCAGTGGGACTTCTGGACCAACAACCCCGAG......TCGGCGCACCAGGTGACCTACCTGATGGGCCCG...CGCGGCCTGCCCCGCACCTGGCGTGAGATGAACGGCTACGGCTCCCACACCTACCTGTGGGTCAACGCCCAGGGTGAGAAGCACTGGGTGAAGTACCACTTCATCTCCCAGCAGGGCGTGCACAACCTCTCG...AACGACGAGGCCACCAAGATCGCCGGCGAGAACGCCGACTTCCACCGCCAGGACCTGTTCGAGTCCATCGCCAAGGGCGACCACCCCAAGTGGGACCTCTACATCCAGGCGATCCCCTACGAGGAGGGCAAGACCTACCGGTTCAACCCCTTCGACCTGACGAAGACGATCTCCCAGAAGGACTACCCGCGCATCAAGGTCGGCACGCTGACCCTGAACCGCAACCCGGAGAACCACTTCGCGCAGATCGAGTCCGCCGCGTTCAGCCCGAGCAACACCGTGCCGGGCATCGGCCTGTCCCCGGACCGCATGCTCCTGGGCCGCGCCTTCGCGTACCACGACGCGCAGCTGTACCGCGTGGGC---GCCCACGTGAACCAGCTGCCGGTGAACCGTCCCAAG...AACGCGGTGCACAACTACGCC...TTCGAGGGCCAGATGTGGTACGACCACACCGGCGACCGC---......TCCACCTACGTGCCGAACTCCAACGGCGACTCCTGG
TRN  11011111101111111
NAM  CATA_PENJA/14-400
ASQ  LAIMVAAAVESESSLTDGDA..........GALLLQDISEWDEVFRFDRLEAVERAAHAAAAAAFGAFVARGDWTASAAAAFQAA-GKQIAFMAAFSTVAGAKGS-ATVRDADAFAAKFASAAALQELVGNNSPISFFIFDLLFAAILFASKAKAANQAAFAAAAELAAESLFVRLPS..-LHQVSFFALAgFAAVAAHRHMNGYGSHTFKLVAKDGSVYCSKFWYKADQGQAAEV.WKDAEEVAAEDVDYFRDLNFQAEAAGRYPLWELASQVMTFSDFEIDPFNENIPTKVVPRESVPLIVDAELLLNRNPLNMFAEVEQVFMDVAAASKGADEVEDPLIQ-RQFAYIDTHLSELT--ASYGIPVCRPY.ATVLNDQ.EDGARYDDVQDVLViaPNAFSASAVEVQ
//