EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00039 - fn1)
FAM  PF00039
PID  fn1
DES  Fibronectin type I domain
IPR  IPR000083
ANO  20
ALN  42
AID  0.387438
APH  ((((((((FINC_BOVIN/110-148:0.33104,(((FINC_HUMAN/2206-2245:0.00000,FINC_BOVIN/2085-2124:0.13506):0.75135,FINC_BOVIN/66-104:0.56594):0.06921,FINC_BOVIN/155-194:0.32586):0.30403):0.08062,((FINC_BOVIN/277-311:0.79014,FINC_BOVIN/439-477:0.13045):0.23337,FINC_BOVIN/2130-2167:0.29058):0.10450):0.18944,(FINC_BOVIN/487-524:0.54379,(FINC_BOVIN/21-56:0.52184,FINC_BOVIN/2174-2209:0.24676):0.50246):0.00000):0.11218,FINC_BOVIN/200-239:0.28673):0.10878,(FINC_HUMAN/561-599:0.11639,FINC_BOVIN/530-568:0.00000):0.61130):0.35415,(FA12_HUMAN/135-170:1.27418,HGFA_HUMAN/202-237:0.39119):0.36915):0.81695,TPA_RAT/38-75:0.00000):0.02994,TPA_MOUSE/38-75:0.07575,(TPA_HUMAN/41-78:0.05901,URT2_DESRO/42-79:0.21460):0.09293);
ATP  ((((((((FINC_BOVIN/110-148,(((FINC_HUMAN/2206-2245,FINC_BOVIN/2085-2124),FINC_BOVIN/66-104),FINC_BOVIN/155-194)),((FINC_BOVIN/277-311,FINC_BOVIN/439-477),FINC_BOVIN/2130-2167)),(FINC_BOVIN/487-524,(FINC_BOVIN/21-56,FINC_BOVIN/2174-2209))),FINC_BOVIN/200-239),(FINC_HUMAN/561-599,FINC_BOVIN/530-568)),(FA12_HUMAN/135-170,HGFA_HUMAN/202-237)),TPA_RAT/38-75),TPA_MOUSE/38-75,(TPA_HUMAN/41-78,URT2_DESRO/42-79));
ATL  11.2521
DNO  7
DLN  126
DID  0.549396
DPH  (((((URT2_DESRO/42-79:0.17918,TPA_HUMAN/41-78:0.03529):0.11205,TPA_MOUSE/38-75:0.08316):0.05301,TPA_RAT/38-75:0.00000):0.46381,FA12_HUMAN/135-170:0.49371):0.09207,FINC_HUMAN/561-599:0.40555,HGFA_HUMAN/202-237:0.58218);
DTP  (((((URT2_DESRO/42-79,TPA_HUMAN/41-78),TPA_MOUSE/38-75),TPA_RAT/38-75),FA12_HUMAN/135-170),FINC_HUMAN/561-599,HGFA_HUMAN/202-237);
DTL  2.49322
RID  0.443272
RPH  (((((URT2_DESRO/42-79:0.22464,TPA_HUMAN/41-78:0.06130):0.09912,TPA_MOUSE/38-75:0.08003):0.03148,TPA_RAT/38-75:0.00000):0.76000,FINC_HUMAN/561-599:0.73100):0.47736,FA12_HUMAN/135-170:1.08525,HGFA_HUMAN/202-237:0.58540);
RTP  (((((URT2_DESRO/42-79,TPA_HUMAN/41-78),TPA_MOUSE/38-75),TPA_RAT/38-75),FINC_HUMAN/561-599),FA12_HUMAN/135-170,HGFA_HUMAN/202-237);
RTL  4.14723
LNK  FA12_HUMAN/135-170:P00748:M31315
LNK  FINC_BOVIN/110-148:P07589:
LNK  FINC_BOVIN/155-194:P07589:
LNK  FINC_BOVIN/200-239:P07589:
LNK  FINC_BOVIN/2085-2124:P07589:
LNK  FINC_BOVIN/2130-2167:P07589:
LNK  FINC_BOVIN/21-56:P07589:
LNK  FINC_BOVIN/2174-2209:P07589:
LNK  FINC_BOVIN/277-311:P07589:
LNK  FINC_BOVIN/439-477:P07589:
LNK  FINC_BOVIN/487-524:P07589:
LNK  FINC_BOVIN/530-568:P07589:
LNK  FINC_BOVIN/66-104:P07589:
LNK  FINC_HUMAN/2206-2245:P02751:
LNK  FINC_HUMAN/561-599:P02751:AJ276395
LNK  HGFA_HUMAN/202-237:Q04756:D14012
LNK  TPA_HUMAN/41-78:P00750:L00153
LNK  TPA_MOUSE/38-75:P11214:J03520
LNK  TPA_RAT/38-75:P19637:M23697
LNK  URT2_DESRO/42-79:P15638:M63988
AMK  xxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  URT2_DESRO/42-79
ASQ  CRDEKTQMIYQQQ.ESWLRPEVRSKRVEHCRC---DRGLAQC
DSQ  TGCAGAGACGAAAAAACCCAGATGATATACCAGCAACAA...GAGTCGTGGCTGCGCCCCGAGGTCAGAAGCAAGCGGGTAGAACACTGCCGGTGC---------GATAGAGGATTGGCCCAGTGT
TRN  10010101100011011
NAM  TPA_RAT/38-75
ASQ  CRDEQTQTTYQQH.QSWLRPMLRGNRVEYCRC---NSGLAQC
DSQ  TGCAGAGATGAACAGACTCAGACAACTTACCAACAGCAT...CAGTCATGGCTACGTCCCATGCTCAGAGGCAATCGGGTGGAATACTGCCGGTGC---------AACAGCGGCCTGGCACAGTGC
TRN  10010101100011001
NAM  TPA_MOUSE/38-75
ASQ  CRDEPTQTTYQQH.QSWLRPMLRSSRVEYCRC---NSGLVQC
DSQ  TGCAGAGATGAGCCAACGCAGACAACTTACCAACAGCAC...CAGTCGTGGCTCCGACCCATGCTCAGAAGCAGCCGGGTGGAATATTGCCGGTGC---------AACAGCGGCCTGGTACAATGC
TRN  10010101100011011
NAM  TPA_HUMAN/41-78
ASQ  CRDEKTQMIYQQH.QSWLRPVLRSNRVEYCWC---NSGRAQC
DSQ  TGCAGAGATGAAAAAACGCAGATGATATACCAGCAACAT...CAGTCATGGCTGCGCCCTGTGCTCAGAAGCAACCGGGTGGAATATTGCTGGTGC---------AACAGTGGCAGGGCACAGTGC
TRN  10010101100011001
NAM  HGFA_HUMAN/202-237
ASQ  CFD-ETRYEYLEGgDRWARVRQ-GHVEQ-CECFGGRTW---C
DSQ  TGCTTTGAT---GAGACCCGCTACGAGTACCTGGAGGGGggcGACCGCTGGGCCCGCGTGCGCCAG---GGCCACGTGGAACAG---TGCGAGTGCTTCGGGGGCCGGACCTGG---------TGC
TRN  11011111101111111
NAM  FINC_BOVIN/530-568
ASQ  CQDSETRTFYQIG.DSWEKYLQ-GVRYQ-CYCYGRGIGEWAC
NAM  FINC_HUMAN/561-599
ASQ  CQDSETGTFYQIG.DSWEKYVH-GVRYQ-CYCYGRGIGEWHC
DSQ  TGCCAGGATTCAGAGACTGGGACGTTTTATCAAATTGGA...GATTCATGGGAGAAGTATGTGCAT---GGTGTCAGATACCAG---TGCTACTGCTATGGCCGTGGCATTGGGGAGTGGCATTGC
TRN  10110101110011001
NAM  FINC_BOVIN/200-239
ASQ  CNDQDTRTSYRIG.DTWSKKDNRGNLLQ-CICTGNGRGEWKC
NAM  FINC_BOVIN/2174-2209
ASQ  CYD-D-GKTYHVG.EQWQKEYL-GAICS-CTCFGGQRG-WRC
NAM  FINC_BOVIN/21-56
ASQ  CYD-N-GKHYQIN.QQWERTYL-GSALV-CTCYGGSRG-FNC
NAM  FINC_BOVIN/487-524
ASQ  CIV-D-GITYNVN.DTFHKRHEEGHMLN-CTCFGQGRGRWKC
NAM  FINC_BOVIN/155-194
ASQ  CFDQAAGTSYVVG.ETWEKPYQ-GWMMVDCTCLGEGSGRITC
NAM  FINC_BOVIN/66-104
ASQ  CFDKYTGNTYRVG.DTYERPKD-SMIWD-CTCIGAGRGRISC
NAM  FINC_BOVIN/2130-2167
ASQ  CHD-N-GVNYKIG.EKWDRQGENGQMMS-CTCLGNGKGEFKC
NAM  FINC_BOVIN/110-148
ASQ  CHE-G-GQSYKIG.DTWRRPHETGGYMLECVCLGNGKGEWTC
NAM  FINC_BOVIN/439-477
ASQ  CTT-NEGVMYRIG.DQWDKQHDMGHMMR-CTCVGNGRGEWTC
NAM  FINC_BOVIN/277-311
ASQ  CVT-DSGVVYSVG.MQWLKTQG-NKQML-CTCLGNGVS---C
NAM  FINC_BOVIN/2085-2124
ASQ  CFDPYTVSHYAIG.EEWERLSDSGFKLS-CQCLGFGSGHFRC
NAM  FINC_HUMAN/2206-2245
ASQ  CFDPYTVSHYAVG.DEWERMSESGFKLL-CQCLGFGSGHFRC
NAM  FA12_HUMAN/135-170
ASQ  CFEPQLLRFFHKN.EIWYRTEQ-AAVAR-CQCKG---PDAHC
DSQ  TGCTTTGAGCCTCAGCTTCTCCGGTTTTTCCACAAGAAT...GAGATATGGTATAGAACTGAGCAA---GCAGCTGTGGCCAGA---TGCCAGTGCAAGGGT---------CCTGATGCCCACTGC
TRN  10010101110011011
//