EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08179 alignment
(4 sequences with 47 aa)


Q733L9_BACC1/1-37 MS--------KNNREAKEKKGQP--EPLSGSHKVKNRNHSRQKHHAH
SSPP_OCEIH/1-47 MSKRKMGPKQQKNPELPKSPEQPYGEPLSGSKKEKKANHSGQKHNPH
SSPP_BACHD/1-45 MTERHTAKDIRKNAPKGENPGQP--EPLSGSKKVKKRNHVSQTNGEG
SSPP_BACSU/1-45 MTNKNTSKDMHKNAPKGHNPGQP--EPLSGSKKVKNRNHTRQKHNSS