EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08178 alignment
(3 sequences with 57 aa)


Q6MUJ9_MYCMS/454-510 MSDEKIKKTFEENIKNFITKKLNELGTPLGKWHVEIKNGILNISAGSSWLASLTAKI
GNSA_ECOLI/1-54 MNIEELKKQAETEIADFIAQKIAELNKNTGKEVSEIRFTAREKMTG---LESYDVKI
Q5PCS1_SALPA/1-54 MNSEELTHKAEEEIAALISKKVAELRKKTGQEVSEIEFVPRETMKG---LEGYHVKI