EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08166 alignment
(2 sequences with 77 aa)


O15450_HUMAN/714-787 PYTSSRCRRELYCLLLALLLAPSPRCPPPLACALQAFSLGQREDSLEVSSFCSEALVTCAALTHPRVPP---LQPMG
O15450_HUMAN/568-634 PYSTVRTKVYAILELWVQVCGAS-------AGMLQGGASGEALLTHLLSDISPPA--DALKLRSPRGSPDGSLQ-TG