EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08161 alignment
(17 sequences with 206 aa)


Q9P6A4_NEUCR/378-575 LVK-VVEGLLTVQYQAAWMETFNVLGAMFDAFRWQANPY.LLSVVKSIGEIRGND--SFAGKQEADEVLGKAIRAMGPEAVLNVLPLNLAKPV--.KGQPGRAWMLPLLRDYTSNTNLAHFKSELVPLSAIMFQRVIE-HQGEKNIHIKIFETVVQQIWSILPGYCDLPLDLVEAFDTGFAEMLTNLLYEQVDLRLDICRALRTVV
Q6C6P9_YARLI/386-581 LAE-MATMLLSVQTRASLVDSTNVVAALLDTLRWKSDPF.LVEAVTIIGGLRTEE-SFVNGIPALDNALGSAIRAMGPAKVLELLPLNLSNPS--.SDSPGRAWMLPLLRDNIHNSEIAFFKSEFLPLIEYFDDKIST----TKGATAKVFEALLAQVWSVLPRFCALPMDLQQSFDQSFAELLSNKLYSNIEIRPVICQSLRLLV
Q9C0X8_SCHPO/366-564 ICSFICDALRDIRFRLAYPECFQIISSLCDKLGPHSDPY.LIPALEVIDYLRGSE--GFDGKALVDEAIGSFVRAIGPEAMLRVLPLNLELND--.KDAVGRAWLLPVLRDNIRFANLAHFTNYFVPLSGQLYQKVIE-MNDLDSIPSKLLQTLVDQIWSLLPGYCYLPLDLQSSFTLEFASILVNVLYEQVSLRSVICNSLTALV
Q750G7_ASHGO/412-610 LSE-IFTGFLTINYTHCAKEVLNTLAAAFKKLRHRCNPD.FLRPLEIVGAWRTNEEQFLDFRNAAEQVIGAAIEAMGPETVLGCLPLNLENPS--.DKRPGRAWLIPLIRDHTKNSLLSVFAKEFIPTIRHFESTIEK--LDKESIQCTLLQTVVDQLWSTFPQFCVLPKDLNDVFTDEFAAELASLLYSRIELRTVICNGLKVLV
Q6CIE6_KLULA/412-610 LSE-IFVDLLSIKYTHCAKAVLNVLTATFKKLKYRANPD.FIKPLEIVGSWRTDEQNFLDLRSEAENVIGGAIEAIGVDAVLGCLPLNLISPS--.TSKPGRAWLLPILRDSIQNSTLNTFFKEFLPLIKHFESQFDK--FGKESVQLKVYQTVVDQIWSLLPPFCDLPTDLTEAFSDEVAAELSGLLYSHVELRTTICRALRNLV
Q6FKT8_CANGA/412-610 LSK-IMEDFLSIKFIHCAKEVLNVFASLFVKLRYRSSPY.LIKPLLVVDKWRVNEENYLELRNEAEHVIGSAISSIGPDQVLHYMPLNLQNPS--.DDQPGRAWMIPLIRDHTRNAKLSIFSEEMMPLIKHFESMFGS--LPKESVQLRLYQTIVDQLWSTFPHFCELPTDLQESFTTQFASDISSLLYSEVGLRTTLCHALKVLV
Q12754_YEAST/414-612 IAK-TFIDFLSIRYSHCSREILKILVAAFNKFRYRSNPH.FLKSLKIVDTWRVNEEQFMDLRNEIELVIGASISAMGPEMILAEAPLNLDNPS--.SERPGRAWLLPLIRDYTKNANLATFQNELAPYIKSFQSKFDK--VPEESIQLRVFQTIVDQIWSTLPRFCELPMDLRESFTDEFASELSSLLYSEVELRTTICHALKVLA
Q6BKG4_DEBHA/405-602 IADHIEKELLSIKYQHATKEILELITATILKLRTRCNPD.FLNVLQVVGEWRTNETDSFPHNKEAEDVISASISTMGPDVVLSVLPLNLNGEG--.S---GRAWLLPLLRDNVRFADLSFYRREILPLVELFEQKIKD-ATNKESMHVKILQTIIDQVWSLLPHFCDLPKDMRSSFDDSFAATLSDLMYANVELRIPICHALRLLV
Q6P5B0_MOUSE/472-670 MFR-AVEEGLTYKFHAAWSSVLQLLGVFFEACGKQAHPV.MKKCLQSLCDLRLSP--HFPHTAALDQAVGAAVTSMGPEVVLQAVPLEIDGSEE-.TLDFPRSWLLPVIRDHVRETRLGFFTTYFLPLATTLKRKAMDLAQAGSTVESKIYDTLQWQIWTLLPGFCTRPTDVAASFK-GLARTLGTAINERPDLRVTVCQALRTLI
Q5ZKD5_CHICK/474-672 MFR-SVEEGLTYRFHAAWDGVLQVLEVFFEVCGKQCHPI.MRKCLQSLCDLRLSP--HFPYTTEVDQAVGAAVGAMGPEVLLEAVPLQIDGKEE-.TLDFPRSWLLPVLRDYVQGARLGFFTSYFLPLAATLKSRALEFAQAGKSLESKIYDTLQWQVWTLLPGFCTRPTDVVEAFK-GLARTLGMAISERPDLRPTVCQALRTLI
Q5XG51_XENLA/474-672 MFR-CVEEGLSYKFHSSWSYVLQVLQTFFEAAGKNCHPF.MKKCLQTLADLRSSA--HFSCTGELDRAVGAAVESMGPEVVLKAVPLQINGTED-.SCDFPRSWLVPVIRDYVKNTELGFFIKYFLPLAAKLKTRASELSQEGRNLESKIYDTLQWQIWTMLPGFCTKPTDVVDSFK-GIARSLGMAISDRPDLRLTVCQALRTLI
Q6DEG9_BRARE/469-667 MFH-IVEEGLSYRFHASWPFVLKILGCFYRAAGKQAHPI.MIKSLQSLSDLRATP--QFPFTGELDLAVGGAVESMGPEVVLNAVPLLITGTDD-.DLEFPRSWLIPVIRDHVKNSQLAYFNSHFFPLANKLKQTADELEQSGQKLMAKVYQTLQMQIWTMLPGFCTKPTDLLVSFK-GIARSLGMALNDRPDLRMCICQALRTLI
Q60T24_CAEBR/455-652 LLS-QLHAAMTMKSASVWKFILRAQMKLFEACGDGLQGAeLTKVLEDLARLRQSD-ECF-CKAELDFTIGAAVRHIGVAAVMNVLSLDVDPDAAIlSTDFTRSWLLPVLRVNIHNAPISLFISHFLPIAMKIHRRLPT-LQAQVQ---RLYSTFQFQLWELLPSFCESPSDLETSFP-DIAPILGAALNERKDLRMTVLNAIRRAL
Q960Z7_DROME/133-327 IIA-SLHKMLNAPFGEISRFVILIFSFVFEACGKLFGSE.LTPPLMTICKRYDTQ---SAHRLQIEHTVISAIKALGPELVLTAIPLADGKG---.VMQLERSWLLPLLREGANGASLQFFKEKIVALAMDCQLKWKEFAEAKNNSSSHIYELLCCQLWGLFPGFCRQPRDP-EYLR-YLAPTLGAAVEKNPEFRPPIYDGLMELL
Q7QD52_ANOGA/511-705 LKY-IIDVLCTAPFGHASKQVLIILAIAFDTTGRYFGET.LAPALTTLGARYDPQ---SSNRIQIEHAVLQAVGSMDTQLVLKCIPLAGSDG---.KIDLDRTWMLPLLREGLQHSSFELFNSVILKLAYQCYMLWQKFKETDNKHQSHIFELLCCQLWGLFPGFCRKPKDV-SNFR-LIAKTLGMVLNENPDLRAPILDGLKELI
Q6K824_ORYSA/158-352 ICA-ILEGLLNVRYGDVWDKSFHVISMAFDKLGESSADL.LPEALKNLADMQNLSDDDFSFRKQLDSCLGSAVAAMGPKNVLKILQIH-------.SISDENEWIFPILEKHIVGASLQFFLTDIRDIIRAVEKNIPKLLKEDKLFSAKRAEGYVYSLWSLLPSCCNYARDTSIHFR-ALQNVLCDTLKNQLDLRGIICSSIQVLI
O80784_ARATH/1467-1665 LCA-TVESLLDYKYHAVWDMAFQVVSAMFDKLGEHSAYF.MRNTLQGLSDMQDLPDEGFPYRKQLHECVGSALGAMGPETFLSIVRLNLEAN---.DLSEVKVWLFPILKQYTVGGRLSFFTEAIFSMVETMSHKAQKLKLQGLPVASRSVDSLVYSLWALLPSFCNYPVDTVESFA-DLGRILCGVLQTQAETHGIICASLNILI