EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08156 alignment
(32 sequences with 68 aa)


Q6UNN3_9HYPO/3-67 LFVLAETPAGYGLFKAAD-KKLFKNK--DLAAELGRPEKLVEMLKLKKFVKFESAAMALEEAASLKEG
Q8X066_NEUCR/3-67 LFILTETSAGYGLFKAAD-KKLLSSD--NLAERLNSVEKITKEIKYKEFAKFESAATALEEIAGVVEG
Q6CG46_YARLI/2-66 TFILTETSAGYAVLKAKD-KKIYKSE--SILEELSTPELVTSQFKVKGFSKFDSAASALEEVNAIVDG
Q6BIX6_DEBHA/2-66 AYVLTETAAGYALLKASD-KKIYKSS--SLIEDLNTVEKVTEQFKIHRFEKFLSAANALEEANAIIEG
NOP58_YEAST/2-66 AYVLTETSAGYALLKASD-KKIYKSS--SLIQDLDSSDKVLKEFKIAAFSKFNSAANALEEANSIIEG
Q9P7S7_SCHPO/1-65 MFILTETAAGYAIFKAKD-KLLKKRD--ALIEDLKSPEGASNLLKLQSFAKFESTVDALDNVSALVEG
Q9MAB3_ARATH/2-67 VLVLYETAAGFALFKVKDEGKMANVE--DLCKEFDTPDSARKMVKLKAFEKFDNTSEALEAVAKLLEG
O80401_ORYSA/1-66 MLVLFETPAGFALFKVLDEGKLDKVE--DLWKEFTTSDSARKVVELKAFNKFENTSDALSAATLIIDS
O65335_PEA/1-66 MLLLFETAAGFALFKVLDEGKLSKVE--DLQQSFSSADTARKVVKLKAFSKFENTSEALKSANLLIDG
O65334_PEA/1-66 MLVLFETPAGFALFKVLNEGKLSEVQ--DLSLDFSTADAARKVVKLKAFSKFENTAEALEAASCLIDG
Q7ZXX3_XENLA/1-66 MLVLFETAAGYAIFKVLDESKLQEVD--SIWKEFETPEKANKVVKLKHFEKFQDTTEALAASTALVEG
Q7QK65_ANOGA/1-66 MFVLYETPAGYAIFKLLDDNKFKEID--NLYLEFETPEKANKIVKLKHFEKFADTTEALSAATAAVEG
O45012_CAEEL/1-66 MLVLFEVAAGYAVFKLSNEKKLKNVD--NIWEEFSTAEKAQENLQLVSFKKFKTTAGAVEATSEITEG
Q7RCR7_PLAYO/1-67 MLILVETAAGYGLFKVEN-SKLIESDASDIAKYFETAEEGKKNVSLYSFTKFKKFQNAFDDINKLTES
Q7QTS4_GIALA/1-66 MYLLYEAASGLAMFKVLDESKLKAAD--LVGAMMRTSSDVQKIVSLVSFSKFPSVEGALATQTSTFEK
Q9LTV0_ARATH/3-69 IYLLSESPSGYGLFE-GHGSDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPFQSALDALNQINAVSEG
Q8H2U5_ORYSA/3-69 LYLLFESASGYALFH-AHGVDEIGQGVDAARASVLELQRFSKAVKLAGFSPFSSAVDALNQCNAISEG
Q5ZMD0_CHICK/4-70 LHVLFEHAAGYALFA-VREVEEIGLLLPQVEESVLTVGKFHNVVKLVAFSPFKSAQSALENMNAVSEG
NO56_HUMAN/4-70 LHVLFEHAVGYALVA-LKEVEEISLLQPQVEESVLNLGKFHSIVRLVAFCPFASSQVALENANAVSEG
Q8IGT5_DROME/4-70 LYVLYEHAAGFSLFS-VKEFEEVSMFLPQVESSVTDLAKFNSIVKLAGFAPFKTAIAALENINAISEG
Q7PUS0_ANOGA/2-68 LYVLYEHAAGYGLFS-VKEFEEIGMLLPQVEASILDLSRFNAIVKLVGFHPFKTAVAALNNVNAISEG
YZVL_CAEEL/6-72 HFVLYEHAAGYALMK-IKEFDDAGLILQEVDAAHADGYKFSQIVELASFDPFKNTEAALENCNSISEG
Q6C8T5_YARLI/6-73 DYVLFEEASGYALFKVLLQPENIGARVKEVQESCTDFNKFSKLVKLVSFAPFKGAAHALENANDISEG
Q6BIZ9_DEBHA/5-72 DYLLFEEATGYAIFKVLIQQDDISSRLKEVQEASNDLAKFSKMVELVSFAPFKGAAQALENANDISEG
Q75CR3_ASHGO/5-72 EYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAAHALENANDISEG
O94514_SCHPO/3-69 DYLLYESATGYSLFDVVG-ADQIAAKTKEVQLSLQDISKFGKVVQLRSFIPFKNAAHALENANDISEG
Q7S0H3_NEUCR/75-142 NYLLFESAVGFSLFEVVHQADTVGLELPEVKDAMKDLDKFGKMVKLRSFNPWNSAAHGLEAINLISEG
Q9BHU7_LEIMA/5-71 LYTLYEAPTGYAIFK-VRTTEEIGAEDVALQKELQRFSTFSPWVKLVSFAPFESPENALEDAVCISEN
Q8III3_PLAF7/4-69 LYILFECSAGYFLLK-IEEWEQIGNT-EELEKKILKSDIFHQMVEFCAFIPFETAERALDNLLNINEG
Q7R4B4_GIALA/2-68 RYLLFESAAGIAIFS-IKEFDDVAKFTAELQRSIADGGAFSTLVKLSSFHRFSGNEDAAAVCAALQEG
Q8SQL0_ENCCU/2-62 EHLLFEYAGGYGLFVLREHEDMSRST-------YDDYTKLTQVLSFKSGMRFSGLSDALEHLRCLSRG
Q98S24_GUITH/1-67 MLILYDSVIGYCLFS-VNENIINKYIDIEYENFISSYQNFSKIFKIKFFLPFKSLKHSLQNTVLINQS