EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08136 alignment
(2 sequences with 47 aa)


RS22_SALTY/1-47 MKSNRQARHILGLDYRISNQRKVVTEGDTSSVVNNPTGRKRRADSQK
RS22_SALTI/1-47 MKSNRQARHILGLDYRISNQRKVVTEGDTSSVVNNPTGRKRRADSQK