EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08129 alignment
(2 sequences with 57 aa)


Q9L9U6_ENTFA/1-57 MKQYKVLNEKEMKKPIGGESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH
Q8VPA2_ENTFA/1-57 MKQYKVLNEKEMKKTIGGESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH