EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08114 alignment
(2 sequences with 43 aa)


PMP1_YEAST/1-40 M---TLPGGVILVFILVGLACIAIIATIIYRKWQARQRGLQRF
PMP2_YEAST/1-43 MLMSTLPGGVILVFILVGLACIAIISTIIYRKWQARQRGLQRF