EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08107 alignment
(4 sequences with 42 aa)


PLE3_PSEAM/1-42 MKFTATFLVLSLVVLMAEPGECFLGALIKGAIHGGRFIHGMI
Q7T054_PSEAM/1-42 MKLAAAFLVLFLVVLMAEPGESFLGFLFHGIRHGIKAIHGMI
Q6JWQ9_EPICO/1-42 MRCIALFLVLSLVVLMAEPGEGFIFHIIKGLFHAGKMIHGLV
MORO_MORSA/1-42 MKCATLFLVLSMVVLMAEPGDAFFHHIFRGIVHVGKTIHRLV