EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08081 alignment
(7 sequences with 45 aa)


Q6IRQ4_XENLA/148-192 RSSEMGGRAPLSRERDGYGAPPRRDPMPSRRDVYMSPRDDGYSGK
O97767_MACEU/171-215 SSRQMGGRGQLSGGRDSYGGPPRRESLSSRRDVHMSPRDDSYSTK
ROG_MOUSE/170-214 SSSGMGGRTPVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTK
O75526_HUMAN/173-217 SGGGMRGRALAVRGRDGYSGPPRREPLPPRRDPYLGPRDEGYSSR
Q9DAE2_MOUSE/170-214 SGAGIRGRAAGSRGRDGYGGPPRRELPPPRRDPYLGPRDEGYSPR
Q6TLG7_BRARE/155-199 RSAPSGPMGRPSRDRDPYGPPPRRDSLMSRRDDGPPHRDDHYGSK
Q15376_HUMAN/174-218 SNSWMGSQGPMSQRRENYGVPPRRATISSWRNDRMSTRHDGYATN