EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08071 alignment
(14 sequences with 39 aa)


O14378_SCHPO/3-40 RGPKKHFKRVAAPHHWLLDKLS.GTYAPKPSPGPHKARE
Q6PBC4_XENTR/3-40 RGPKKHLKRVAAPKHWMLDKLT.GVFAPRPSTGPHKLRE
Q7PT95_ANOGA/2-39 RGPKKHLKRLNAPRGWMLDKTG.GTFAPRPSTGPHKLRE
RS4_YARLI/3-40 RGPKKHLKRLAAPSHWMLDKLS.GTYAPRSSAGPHKLRE
Q6QU83_MAIZE/3-40 RGLKKHLKRLNAPKHWMLDKLG.GAFAPKPSSGPHKSRE
Q7R3M9_GIALA/3-40 RGVRKHLKRLNAPKHWLLDKMG.GIWAPRPTNGPHGLRE
Q8IIU8_PLAF7/24-61 KGIKKHLKRVNAPSHWMLNKMG.GQYAPKTSSGPHKLLE
Q9XG32_GUITH/3-40 RGIKKHYKRLNAPKKWLLNKLG.GIWAPRSSSGPHKKQN
Q8SRB9_ENCCU/3-40 TGHRDHLKRKTAPKSWMLDKQG.GTFALMPASGPHKKTE
RS4E_METJA/4-41 KGPKRHLKRLAAPVRWELPRKI.HKFTVRPLPGAHPMSE
RS4E_METVA/4-41 KGPRKHLKRLAAPANWQLPRKE.RTFTVRPSPGPHSMDK
RS4E_PYRHO/4-41 KGPKRHLKRLAAPSSWYIERKA.YKWAVRPRPGPHNMRT
RS4E_METKA/6-44 SGPKRHVKRLAAPYAWPIPRKEgGKFAPRPYPGPHTMDT
RS4E_METTH/4-41 MASRKHLKRFKSPVHWPIHPKE.YKWTVKPSPGPHAIEN