EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08052 alignment
(2 sequences with 44 aa)


Q83P61_SHIFL/1-44 MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLNRGAFFCLGVRR
LPPY_ECOLI/1-44 MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLNRGAFFCPGVRR