EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08020 alignment
(14 sequences with 177 aa)


Q8FGD0_ECOL6/1-167 MA-VPSSKEELIKAINSNFSLLNKKLESITPQLAFEPLLEGHAKGTTISVANLVSYLIGWGELVLHWHDQEAKGKTIIFPEEGFKWNELGRLAQKFYRDYEDITEYEVLLARLKENKQQLVALIERFSNDELYG---KPWY------NKWTRGRMIQFNTASPYKNASGRLNKLQKC
Q6D578_ERWCT/1-167 MA-VPESKEALIKAINSQFTLLMKKIDAVPAERAFSPEMAGHAQGTQMSPANLVAYLLGWGNVVLKWHEDEEQGKTIDFPEAGYKWNQLGLLAQKFYQDYAPITDWAELIALLAANKLALIALVERYTDEQLYG---EGWY------GKWTRGRMIQFNTAAPYKNAAGRLRTWEKN
Q9L910_ECOLI/1-166 MS-VPQTKAELLLAIDKNFSKLISYLNTIPPEITSDKSMDGHAKGTEMSVRDLVSYLLGWNALVVKWIASDAKGLPVDFPETGYKWNQLGLLAQKFYSDYSEL-SYELLVAELQTVKNEIVNLINDRTDDILYG---RPWY------TKWTMGRMISFNTSSPYANANGRLRKWAKN
Q8EG45_SHEON/1-167 MSSVPQSKQELELAIHSVFPKLMADYRSIPAQMSRVCSIDGNIQGTQISVCDTVAYLIGWGKLVLKWYELTSQTLPVDFPDTGYKWNQLELLADRFHQEYHQW-QYSDLLNEYELTMAKLLTLIASLSVQQLYG---IAWY------DKWTLGRMIQFNTYSPMKNMRTKVRRFKKD
Q87NK8_VIBPA/1-167 MSSVPKNKDELELAINSIFPKLMVDYRSIPESKARKVGVEGNVKGTFISVSDTVAYLIGWGKLVLKWHRLKSQNQHVDFPETGYKWNQLGLLAESFHEEYRDW-KYSDLLVELEFTINEILLLISSLSDHELYG---VAWY------EQWTLGRMIQFNTSSPMKNMRTKVRRFNRE
Q6LQQ6_PHOPR/1-167 MSSIPQNKDELINAITFVSGRLLDDYRSIPDELSRTIAIEGNVKGTAISVCDTLAYLIGWGKLVLKWYSLQSQGQSVDFPETGYKWNQLGLLAQSFQKDYQNW-DYPSLQSEFTTTTQDILLLVVSLDNHALYG---VCWY------EKWTLGRMIQFNTSSPMKNVRTKVRRFKKI
Q03036_YEAST/1-167 MR-EYTSKKELKEEIEKKYEKYDAEFETISESQK-----DEKVETVDRTPSENLSYQLGWVNLLLEWEAKEIAGYNVETPAPGYKWNNLGGLYQSFYKKYGIY-SIKEQRAKLREAVNEVYKWISTLSDDELFQAGNRKWA---TTKAMWPVYKWIHINTVAPFTNFRGKIRKWKRL
Q839W6_ENTFA/1-167 MR-TYESKEALIEAIQIASQKYLAEFAEIPETLK-----DHRIETVAKTPSENLAYQLGWLNLLLSWEEQEQRGLTVQTPAEGYKWNQLGALYQSFYQTYGQM-SLESQLIALQDTLEKLLHWIDSLSEDELFLPQQRAWA---TTKAQWPLWKWIHINSVAPFTSFRTQIRKWKKA
Q9CN16_PASMU/1-170 MR-HYTSKTALKNAIQQTYEKYLSEFETIPEDLK-----ETGCTEVERTPVQNLAYQVGWTSLLISWEQDERKGLLVKTPSEHFKWNQLSELYQWFNQTYAHL-SLAELKSRLAHNIETIYYLIDTMSDKALFSQHQRKWADNATKNAKWTVFQFIHVNTVAPFTSFRTKIRKWKKH
Q8DQ54_STRR6/10-179 LR-TYENKEELKAEIEKTFEKYILEFDNIPENLK-----DKRADEVDRTPAENLAYQVGWTNLVLKWEEDERKGLQVKTPSDKFKWNQLGELYQWFTDTYAHL-SLQELKAKLNENINSISAMIDSLSEEELFEPHMRKWADEATKTATWEVYKFIHVNTVAPFGTFRTKIRKWKKI
Q8DWV2_STRA5/1-170 MR-TYSDKNELKEEVLKSYKKYIAEFNDIPEKLK-----DLRIDEVDRTPAENLAYQVGWTTLILKWESDEQSGLEVKTPTETFKWNQLGELYQHFTETYASL-TIKELTAQLNDNVDAIGNMIDSMSDEVLFKPHMRNWADSATKNAVWEVYKFIHINTVAPFGTFRTKIRKWKKV
Q8RFR2_FUSNN/11-180 MK-EYTSKVELTSAIKASYKKYIDEFENISEDLK-----DKRFEKVDRTPAENLAYQVGWTTLLLKWEKDEKAGLEVHTPSENFKWNNLTELYKWFNKEYSHL-SLAELKSILNKNISDIYKMIDEMSEDELFKPHQRKWADNSTKTAVWEVCKFIHINTVAPFGTFRTKIRKWKKL
Q71WY9_LISMF/1-166 MV-RPKNKVELLQQSTEKYQQLNDLINSIPKEKQ---QLTFPFEDRDKNIRDVVIHLHEWHKMALDWYEVGMGGKKPLMPAEGYTWKTTPELNLVIWQKYQET-DLAQARELLDETHNKEMVLIAGHSEEELFTKKYYKWT------NTTSLGAIFISSTSSHYDWAIKKIRKFKKA
Q73PY6_TREDE/1-166 MP-RPTTKEDLIFASNEQFEKLWNLIDGMTEKER---TADINPNERDKNVRDVLVHLYEWHCLLLNWIKSNTKGKPAAFLPEAYNWKTYPEMNVEFWKKHQGT-PYADAEKMLKKTHKEVMKLIETFSNEELFSKAVFNWT------GTTTLGSYCVSATSSHYDWAIKDIKKALKK