EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08017 alignment
(3 sequences with 509 aa)


Q84EL5_STRAG/1-186 MFNKI--------------------GFRTW-------KSGKLWLYMGVLGSTIILGSSPVSAM--DSVGN-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLERR--------------QRDAENKSQVGQLIGKNPLLSKSIISRE---------NNHSSQGDSNKQSFSKKVSQVTNVANRPMLTNNSRTISVINKLPKTGDDQNVIFKLVGFGLILLTSRCGLRRNEN
Q84EL4_STRAG/1-312 MFNKI--------------------GFRTW-------KSGKLWLYMGVLGSTIILGSSSVSAM--DSVGN-------QSQGNVLERRQRDAENRSQGNVLERRQRDAE--------NRSQGNVLERRQRDAENRSQGNVLERRQRDVENKSQGNVLERRQRDAENRSQGNVLERRQRDVENK------------SQGNVLERR-------QRD------------------------------AENRSQGNVLERRQRDAENRSQGNVLERRQRDA-------------------------------ENRSQGNVLERRQRDAENKSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLERR--------------QRDAENKSQGNVLERR---------QRD---------AENRSQG---------------NVLER-------RQRDVENK-----SQGNV-----------LERR---QRDAE
Q6BGL7_PARTE/1-500 MVKQLFTEQEKQDLLKKKAKEIREEFFQTYVPIQNAEESEKKKLMKKVPWNEHMTATSDDKILIDATLGNEEAQREVQIYQITFANVQRSIAYLTQEGVPVQRPDDFEVEMFKSPKQMDKINLKIEKKRDEKNKKEEEKMKKHSKKL--NKQMKIKKMREEHKEKRQNKVAIEQWKKEIKEKGSDKARDLDEIIKQNNQISKKFKKDKNQQQDGIKKNSMFKQKNGKFKKTGKMRTQDNSFQKGENRNFGQRSQSSDGFRNNKFEGKPQNSRSFSAQGGQRNNKQFGGDSHSQERKPFGGRGKSFGGENRSEGNSFRGRGRGSENRSEGNSFRGRGRGGDSRSQGNSFRGRGRGGDNRSQGTSFRGRGRGGDNRSDGNSFRGRGGKSFGGRGKSFGSDNNSEGKSFGGRGRGRGGQFGGQRGGRSFGGRGKSFGNENRSEG----KSFGRGGKFGGQQGGRPFRGKPQGGKSFGGKQHGGNKKGNQSFKSNKSFGKGQSFR---QKGKK