EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08003 alignment
(11 sequences with 326 aa)


Q7UAC4_SHIFL/1-322 MIDFGNFYSLIAK-NHLSHWLETLPAQIANWQREQQHGLFKQWSNTVEFLPEIKPYRLDLLHS.VTAESEEPLSTGQIKR.IETLMRNLMPWRKGPFSLYGVNIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGAHLAVGIDPTQLFLCQFEAVRKLLGNDQRAHLLPLGIEQLPA-LKAFDTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVYFIPSALALKNWLKKCGFVDIRIVDVCVTTTEEQRRTEWMVTESLSDFLDPHDPSKTVEGYPAPKRAVLIARK
Q6D482_ERWCT/1-322 MIDFGNFYQQIAK-GPLSHWLNTLPSQLSSWQQESLHGKFKLWFNSLEHLPSLKPTSLDLNDS.VTARIEPDISVGQREG.IEKLLRNLMPWRKGPFSLYGVDINTEWRSDWKWQRVLPHISPLKNRLILDVGCGSGYHLWRMVGEGATMAVGIDPMQLFLCQFEAVRKLLGDDQRAHVLPLGIEQLPE-LAAFDTVFSMGVLYHRRSPLDHLWQLKNQLVAGGELVLETLVIEGDENQVLVPGERYAQMRNVYFIPSAVALTTWLEKCGFVDVRIVDICTTTTQEQRRTDWMITESLAEFLDPEDPTKTVEGYPAPVRAVLVARK
Q7N556_PHOLL/1-322 MIDFGNFYQLIAK-NNLQHWLNCLPAQLQEWQKAALHGNFKSWVKTLENLPEISPTQLDLKNG.VIAERDPPLSAGEKIC.LTNILRIFMPWRKGPFSLYGINIDTEWRSDWKWDRVLPHISPLTGRTILDVGCGSGYHLWRMVGEGAELAVGIDPTQLFLCQFEAVRKLLGNDQRAHLLPLGIEQLPA-LAAFDTVFSMGVLYHRRSPLDHLWQLKNQLISDGELILESLVVEGDEHTCLIPGERYAQMRNVYFIPSAKMVKIWLEKCGFVDVKIVDQAVTATEEQRRTDWMKTESLSDFLDPTDSNKTIEGYPAPLRAILIARK
Q9KSU3_VIBCH/1-322 MFNFANVYQQIAQHPQLQLWLNTLPQQLTDWQ-AKQHGDLDRWMRNLKKIPVGQPEVIDLKNA.VAAHNHQPLAQGEQKK.LEAVLKTFHPWRKGPYHLHGIHIDTEWRSDWKWDRLLPHISPLKNRLVLDVGCGNGYHMWRMLGEGAQQVFGIDPSELFLIQFEAVRKLLGDDQRVHLLPLGIEQMPE-LNAFDTVFSMGVLYHRRSPLDHLLQLKNQLVAGGELILETLVVEGDEHTVLVPFDRYAQMRNVYFFPSALALKVWLEKTGFVDVRIVDENITSLGEQRTTEWMTHNSLPDYVDPQDPSKTIEGYPAPRRAILIAKK
Q7MJ71_VIBVY/1-322 MFNFANFYQLIAQDTRLQPWLNVLPQQLTDWQ-NAEHGDFPRWLKALNKIPEGAPDQIDIKHS.VTISNDTPFHQGELKK.LESLLRTFHPWRKGPYTVHGIHIDTEWRSDWKWDRVLPHISPLKNRSVLDVGCGNGYHMWRMLGEGARLCVGIDPSHLFLIQFEAIRKLMGGDQRAHLLPLGIEQLPK-LEAFDTVFSMGVLYHRRSPLDHLIQLKDQLVSGGELILETLVIEGDETAVLVPKERYAQMRNVYFFPSARALKVWLELVGFEDVRIVDENVTSVDEQRTTNWMTHNSLPDYLDQNDPSKTVEGYPAPRRAILVAKK
Q6LT56_PHOPR/1-322 MFSFSEFYKLIAQHETLRPWLNTLPKQLSDWE-EAEHGDMGRWIRALKKFPTDKPDIIDIKNE.VSVRYEDGIANGEQKR.LESLLRLLHPWRKGPYNMHGIHIDTEWRSDWKWDRVLPHISPLQGRSVLDVGCGNGYHMWRMLGEGAALTVGIDPSNLFLIQFEAIRRLMGDDNRAFLLPLGIEQLPE-LKAFDTVFSMGVLYHRRSPLDHIIQLKNQLRKDGEVILETLVIEGDENAVLVPTGRYAQMHNVYFFPSAKALKVWMEKCGFVDVRIVDESVTTTDEQRSTDWMTNNSLPEYLSPDDPTKTIEGYPAPKRAILVARN
Q8EEE6_SHEON/1-322 MINFSSFYQQIAD-SNLQHWLETLPAILGKWQREHKHGNLPKWEKVLNKLHYPSPDSVDLVDS.VTIGTGEQLTPGEKEK.LENLLRLFMPWRKGPFHIHGIHIDTEWRSDWKWDRVKPHISPLQNRTVLDVGCGSGYHMWRMLGAGAKRVVGIDPSPLFLCQFEAVKRLSGENHPVHLLPLGIEELPP-LDAFDTVFSMGVLYHRRSPIDHLLQLRDQLRMGGELVLETLVIDGDENAVLVPQDRYGKMNNVWFIPSVAALMLWLKKCDFTDIRCVDTDVTALAEQRRTDWMPNESLVEYLDPKDITKTVEGYPAPKRATIIAVK
Q7VL50_HAEDU/1-320 MIDFRPFYQQIAT-SHLSAWLETLPLQLKQWE-KTAHSDYAKWAKIATSMPT-SPTSINLTDK.VEAVLAEALPEGEKQY.LIYRLKQLMPWRKGPYHLHGVHIDTEWRSDFKWQRVLPHLAPLKDRTILDVGCGNGYHMWRMVGEDAQMVVGIDPTELFLCQFEAVRQLLGNDRRANLIPLGLEQMQP-LAAFDTVFSMGVLYHRKSPLDHLSQLKAQLVKGGELVLETLIIDGDINDILTPADRYAKMKNVYFIPSVAALINWLKKIGFKNARCVDQSVTTLAEQRKTEWLENESLVDFLDPTDQRKTIEGLPAPKRAVILANA
YECP_HAEIN/1-321 MIDFRPFYQQIAT-TNLSDWLETLPCQLKEWE-TQTHGDYAKWSKIVDFLPNLHADEIDLKSA.VKSDRTSPLSEGEKQR.IIHHLKQLMPWRKGPYHLFGIHVDCEWRSDFKWDRVLPHLSPLQGRTILDVGCGSGYHMWRMVGEGAKMVVGIDPTELFLCQFEAVRKLLNNDRRANLIPLGIEQMQP-LAAFDTVFSMGVLYHRKSPLDHLSQLKNQLVKGGELVLETLVVDGDINTVLVPADRYAKMKNVYFIPSVATLINWLEKVGFTNVRCVDVATTTLEEQRKTDWLENESLIDFLDPNDHSKTIEGYQAPKRAVILANK
Q87XG5_PSESM/1-318 MIDLAPLVRRLAG-TPLAEWANGLQAQLDTKM-SKGHGDLQRWQSALDALPALQPEKVDLTDS.FTLETE---CDGETRTvLRKALLGLSPWRKGPFNVFGVHIDTEWRSDWKWSRVSPHL-DLKGKRVLDVGCGNGYYQWRMLGAGADSVIGVDPNWLFFCQFQAMQRYL-PDLPAWHLPFALEDLPANLEGFDTVFSMGVLYHRKSPIDHLLALKDCLVKGGELVMETLVIPGDVHQVLVPEDRYAQMRNVWFLPSVPALELWMRRAGFTDVRCVDVSHTTVEEQRSTEWMRFQSLGDYLDPNDHSKTVEGLPAPMRAVIVGRK
Q6AIL0_DESPS/1-318 M----KYLKHLSD-AADREAIKALHDERQTWV-NQEKKGFLRYREPYLQLARFKADSINLENDvVTIGHGEQISHEEQAE.IRQALRAYMPWRKGPFAVFGVDIDAEWRSERKWQRLEKHLPDLKGKVIADIGCNNGYYMFRMAAQEPAFVLGIEPSVQHYYCFKALEEMSGLTNLEIDL-LGVEHLPLFTESFDVVFLMGIIYHRSAPIETLRAVLDSLKPGGTLILETQGIPGEQPYALFPDKTYAKVPGTYFVPSASCLINWMHKAGFIDVDLFCDHPMSPEEQRQTEWMEFESYKDFLDPENPELTLEGYPAPHRFFVKATK