EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF08000 alignment
(16 sequences with 123 aa)


Q8LTS8_9CAUD/4-124 FNNASFIKLKPTNDDAFVNNISPIFVKGESILGTYKGIRDGVVFTTHRIIAINVQGITGKKKDFTSLPYSKIQTFSIETAGTFDLDSELELWFSSLGK--VKLEFSSRANVSEIAKIISERIL
Q8KQ26_9LACT/4-124 FNNSAFVKLKPTSNDVFQDMISAILTDKESLISTYKGMRDGVVFTTHRIIAINVQGITGKKKDFTSLPYSKIQAFSIETAGTFDLDSELELWFSGLGK--VKLEFVSQANVSEIAKIISNKIL
Q87FW9_VIBPA/22-142 FDNSSVFKLKPIDVSKVRDDFHKFLIDGETIFTAFKTVRDQVVFTNKRVIAANVQGITGSKVDYTSLPYSKINAFSIETSGTFDLDCEIEFFLSEVGR--VRFEIKGSFDLVAFNRMISERVL
Q6ANG9_DESPS/4-124 FDKSELFKLKPIDNSKALEAISLFLIDGEKIFATFKTIRDQVVFTNKRIIAANVQGLTGSKVDYTSIPYAKIQTFSVETSGSLDLDCEIEIYISAVGR--VAFEIRGSFDIVGFNRLISQHIL
Q8ELK9_OCEIH/3-124 LFDGIMGNASEVDNGKIEEEFQQVLAESENIERTYKLIRDLFIFTNKRLILVDKQGVTGKKMEIHSIPYKNIVHFSIETAGSFDLDAELKIWISGNSVP-FQKQFNKSLNIYEVQTVLASYVL
Q898N1_CLOTE/15-136 IFDGLMGNASEVNSEQVKKEYAHILAPNEKIEKSYKLIRDMFIFTNKRLILVDKQGVTGKKTEYHSIPYRAITHFSIETVGHFDLDAELKIWISGSSTP-VEKQFNKSLNIYELQSVLAEYVL
Q8E0G0_STRA5/3-125 IFSGLMGNASQMDTDKVENQLSDILISDEQVDLAYTLIRDLIVFTNYRLILVDKQGVTGKKVSYNSIPYASISRFTVETSGHFDLDAELKIWISSAIEPAEVLQFKNDRNIVSIQKALATAVL
Q8E634_STRA3/3-125 IFSGLMGNASQMDTDKVENQLSDILISDEQVDLAYTLIRDLIVFTNYRLILVDKQGVTGKKVSYNSIPYASISRFTVETSGHFDLDAELKIWISSAIEPAEVLQFKNDRNIVSIQKALATAVL
Q832M1_ENTFA/3-125 LFDGLLGNATQNNNETAEKELRDVLIPNEKVDMAFTLVRDLIVFTDKRLILVDKQGITGKKVDYKSIPYKSISRFSVETSGHFDLDAELKIWISSTELPSVSLQFRKDKDIVAIQQALAAAVL
O34593_BACSU/3-125 FIDGLLGNASTLSTAAVQEELAHILLEGEKVEAAFKLVRDLIVFTDKRLILVDKQGITGKKTEFQSIPYKSISRFSVETAGRFDLDSELKIWISGAELPAVSKQFKKDESIYDIQKVLAAVCM
Q813J1_BACCR/3-124 LFSGILGNASNTSSESVERDLEKIMLDDEKVEHAYKLIRDLIVFTNRRLILVDKQGVTGKKTEYHSIPYKSITQYSIETAGHFDLDAELKIWVSSMEDP-ITKEFKGDDSILSIQKALVTFTT
Q6HI26_BACHK/3-124 LFSGILGNASNASTESVERDLEKIMLDDEKVEHAYKLIRDLIVFTNRRLILVDKQGISGKKTEYHSIPYKSITQFSIETAGHFDLDAELKIWVSSLSTP-ITKEFKGDDSVLSIQKALVTYTT
Q81PU7_BACAN/3-124 LFSGILGNASNASTESVERDLEKIMLDDEKVEHAYKLIRDLIVFTNRRLILVDKQGISGKKTEYHSIPYKSITQFSIETAGHFDLDAELKIWVSSLSTP-IAKEFKGDDSVLSIQKALVTYTT
Q8EAU5_SHEON/3-124 LLDGLLGNASEVNLQELAEELRPIMGIQEELKLAYKVIRDLFVFTNKRLILIDKQGLTGKKTTYHSVPYKSITHFAVETTGHFDMDAELKIWISGQSEP-LVKELKRGTDVVGIQKTIATFAL
Q6LHY1_PHOPR/3-124 LFDAILGNAGEMSIADATEELSTILGPNEHIEIAYKLVRDMIVLTDQRLLLIDKQGLTGKKVEYRSIPYKAITMYTVESTGHFDLDAELKVWVSGQSEP-ISLEFNGKTNIYAMQGVLTAKIA
Q6NJL6_CORDI/1-120 METASITEWTFVQEVPIPEDVANLMVPGEDAVVAFKTFRDSAIFTTKRLIVRDSQGLRGKKVEVYSLPYSSVNMWSTENAGTFDFNAEVELWTRAGK---IKIKIGRDLDVRRLDMLLAQCIL