EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07986 alignment
(10 sequences with 120 aa)


Q8BLN8_MOUSE/56-174 GQQFVIQDCENCNIYIFDHSATITIDDCTNCVIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQP-IIESSTNIKFGCFQWYYPELAAQFKDAGLSIFNNIWSHVHDF
Q966I6_CAEEL/69-187 GGPLQMENCTDSTILYLYQTSQVIIDDCRHCTIVLGPAAGSVFVRDCANCTIFTSCQQLRTRDCTSIRISILCPTEP-IVENSSDIHFFHLAMRYPELKDQMHAVGLRPFTNRIASVHDF
Q95TP0_DROME/188-306 GQDITISKLNHCLVELQGHPGSVQVSRASKCTLLCGPIARSFFAENLEDCTLSIACQQLRLHSSRSIRIYMHVTCRA-IIEDCKSIEIGEYNYDYSKLEADYLASGLNKAQNNYTDVADF
TBCC_HUMAN/203-321 QRDVLLTELSNCTVRLYGNPNTLRLTKAHSCKLLCGPVSTSVFLEDCSDCVLAVACQQLRIHSTKDTRIFLQVTSRA-IVEDCSGIQFAPYTWSYPEIDKDFESSGLDRSKNNWNDVDDF
Q7QG45_ANOGA/186-304 DQTITASKLKNCLVRIEGHPGSLQFAQLDNCVVVCGPTARSIFLDDCTGCKFVVACQQLRCHRSRDCDMYLNVTSRA-IIEDCSGIRVAAYNYRYENIEEDFRQSGLDLSCNNWHTLDDF
Q8L5R4_ARATH/193-311 IGEFTLSDLDSCQVKLTGTVNALFLHRLKKCSVYTGPVIGSILIDDVEDCVLVLASHQIRIHCARKSDFYLRVRSRP-IIEDSNGVRFAPYCLDYKGIDEDLKTAGLEEETNNWANVDDF
Q6YVY3_ORYSA/199-317 DGDFTLADLVSCQVYLKGKCRALHVHKLKDCRVFVGAVFGSVLIEDVERCAFVMAAHQIRIHEATATDFYLRVRSRP-IIEDCCGVRFAPHALKYEGIGEDLRDAGLEEETGNWANVDDF
Q940S9_ARATH/337-452 GRSVKVVNCHDSVIYLLAPLRYATVHGCSDTTIVLGAVGKAIKVEHCERVHVIVAAKRVCIANCRECVFFLGVNQRPLIVGDNHKLQVAPYNTFYSHLEEHMREVGLEPTINKWDK----
Q69T18_ORYSA/347-464 GHSIKVLNCHDSVIYILAPVKYATVYGCSDTTIVLGAVGKVVKVEHCERVQIIAASKRICIANCRECIFYLGVNHQPLIVGDNHKLQVAPFNTYYPQLGEHLVQVGVDSNINKWDQ--PF
Q9P3T8_SCHPO/143-259 AVKVSAKSLRSCNISI-SNCSSVNLHNATKCNFTFPTIQGSIHLSDINDSTICVSCHQFRLHHSTNLRVHLRCKTSP-VIEESKEISFS-YKDEHPILDFTWARSDPSPHFRITSDLFDA