EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07967 alignment
(5 sequences with 122 aa)


Q9SHI0_ARATH/84-205 WDRGDLLRRLATFKPSNWLGKPKTASSLACAQKGWVSVDLDKLQCEYCGSILQYSPPQDSLNPPEADTTGEKFSKQLDDAHESSCPWVGKSCSESLVQFPPTPPSALIGGYKDRCDGLLQFY
Q6ZLP6_ORYSA/90-209 WERGDLLRRLATFKSSTWASKPKAASSLACARRGWVNIEMDKIACESCGAHLIFT-ALTSWSPAEVANAGEAFAEQLDASHLGDCPWRGNSCADSLVQFHLT-PSALVGGFKDRCDGLLQFI
Q9M997_ARATH/96-216 WDRGDLMRRLATFKSMTWFAKPQVISAVNCARRGWVNDDADSIACESCGAHLYFS-APSSWSKQQVEKAASVFSLKLESGHKLLCPWIENSCEETLSEFPLMAPQDLVDRHEERSEALLQLL
Q6P7H4_XENLA/66-186 TSKDAFFSRVESFSSLKWAGKPPELCPLICAKYGWCNIECDMLKCSSCNAYLCAS-LQPILDFSKYKQRCVELQEALRKAHEKFCFWPDSPCPEHFWALLVTEPSSVLSDFVERFHNLCHLE
Q8CI56_MOUSE/60-180 TSKEAFFHRVETFSSLKWAGKPPELSPLICAKYGWVTVECDMLKCSSCQAFLCAS-LQPTFDFGRYKERCAELKKSLCSAHEKFCFWPDSPSPDRFGMLPLGEPAVLISEFLDRFQSLCHLD