EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07932 alignment
(2 sequences with 97 aa)


Q9ZBA9_OCHAN/422-518 AKHDIIGRYHSDELDADLLLVSEGGAIYGAFEGFLGKSDMYPLYSVGSDVWLLPVQRSMDAPSPGEWKLVFRRDDKGEITGLSVGCWLARGVEYRRV
Q8YD27_BRUME/422-518 ARQDIAGRYRSDELEADLLLVSEGGAIYGAFEGFLGKSDMYPLYAAGPDVWLLPVQRSMDAPSPGEWKLVFHRDAAGRITGVTVGCWLARGVEYKRL