EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07919 alignment
(5 sequences with 172 aa)


Q9H0L1_HUMAN/654-805 NIEGGVATGHYIISWKRTSAMENIPIITTVI--TLPHVIVENIPLHVNADLPSFGRVRESLPVKYHLQNKTDLVQDVEISVEPS--DAFMFSGLKQIRLRILPGTEQEMLYNFYPLMAGYQQLPSLNINL---------LRFPNFTNQLLR---RFIPTSIFVKP----QGR
Q6PGX1_BRARE/372-523 NGTSTVASGHYIISWKRKSTFTETSVVRTVI--TLPHVMVENIPLYVHAEVPSFGRVRESLPVRYHLENRTGLVQDVEISVEPS--DAFMFSGLKQVRMRILPGAEQEMLYNFYPLMAGYQVLPQLNINL---------LRFPNISSQLLR---RFLPSRIFIKP----QGR
Q960U6_DROME/798-961 NPSAVPIFGVFCIRWRRANCKEENESKFVI---RGLDIAEPPLNIYCTIEEKMF--VKMPMAFKVVLKNPTTHVLHLIANLSISKTDNFICSGHKQLDISIMAYEEKELVYNLYPLQVGWQELPVLSLEYNTKADPQKKDSQNALLDELVQ---RALPKRVFVLPPLKQQNK
P90984_CAEEL/951-1101 EDESETPLGRMSVEWRRA-VPNSCPVRSVAPLCRIP-VLACPISISSHIKTNP-AIVRQPIEICFELKSHSKEAVEISTNFDLN--DVFMFSGERKVTMTVLPGATRRVTVVVMALSAGRLNFPKISLKS------------PQISDQTLQQSLRTLPAAIFVLP----KAK
Q9FKY7_ARATH/1036-1188 TRTPKLGLGSIHLKWRREG--GNITEAYVSTKHKLPEVNVEASPLVMSLDSPPYAILGEPFTYAVRICNQTQLLQEAKFGLADA--QSFVLSGSHSNTVSVLPKSEHVLSYKLVPLTCGEQQLPKITLTS------------ARYAAEFQP---SAVASSVFVFPSAPQAEK