EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07908 alignment
(23 sequences with 50 aa)


Q9V2D3_PYRAB/478-525 PHRVKDR-ATYTNPRLPPDGIKYVIVNGVLSVENGEL-TGDAGGVVIRRT
Q7UWE0_RHOBA/511-558 FNELADR-ADFENPHAESVGMKHVVVNGIPVLEDGKF-TGKRPGKVLRGP
Q7NL19_GLOVI/442-489 PARVADR-ATIEAPAAPPVGIEAVMVNGEWVVDGGQV-TGKRPGRVLRRP
NDDD_ALCXX/441-488 PANVTDT-ATFSAPIQVSQGIHAVWVNGRQVWDGERT-GAERPGQVLAPG
NDAD_ALCXX/434-481 PATVADT-ATFEHPTERAAGIHSVYVNGAPVWQEQAF-TGQHAGRVLART
NDED_ALCXX/431-477 ADTVCDR-ATWDAPTLASAGIEHVLVNGCAVFPQAPP--SHRPGRILRRD
Q7VYV0_BORPE/433-479 PDTVADR-ATWDEPTLASVGIAGVLVNGAEVFPQPPA-DG-RPGQVLRAG
Q8XQN5_RALSO/435-482 PDTVRDL-ATFTDPKQPAAGIEAVWVNGALSYRDGAV-QPRRAGRFLRRG
Q87V24_PSESM/430-477 PHTVRDI-ADFKDPQRAAEGIDGVWVNGQLSYAEGKP-QGERQGRFLPRS
Q6LSP3_PHOPR/430-477 PAEIKDA-ATFENPKAKAKGIEAVMVNGCISYQKGEV-DAQRSGRFLYRH
Q7MD91_VIBVY/429-476 PRTVKDT-ATFENPISLAQGIERVFVNGMLAYFNGQV-SKHRNGMFIYRN
Q93JK8_STRCO/487-534 PATVAAG-SSFDEPRVLPTGIPYVLVDGRFVMEDGRR-TDVLAGRSVRRV
Q82I76_STRAW/481-528 PSTVAAG-STFEDPRRLPAGLPHVLIDGRFVVEDGRR-TDVLAGRAVRRT
Q8D645_VIBVU/503-551 LEDIKVL-ATFEAPNALSEGMHHVIVNGTPIIANGELQLGVNPGEPIRNP
Q89DY3_BRAJA/487-535 YEKLSDR-ATFTAMNRPSEGVRHLVVSGQPLISDGILDVTARPGRPVRRP
Q6WSB9_9PSEU/367-415 PHAITDA-ATYFDPTRPSVGVRHLFVSGVPVVTDGNLRTDAFPGKPLRGE
Q7MD66_VIBVY/478-526 PETISDV-GTYQDPNHPAVGVHWLLVNGEIVVNNSELDTTVKAGKAIRRT
Q9A2U6_CAUCR/523-571 PQVAYDLPAGGRRLTQRAHGYVATIVAGVVTQRDGEP-TGALPGRLVRGA
Q89VP1_BRAJA/519-567 PKVHYDLPVGGRRLLQDVDGYEATIVSGVVTRRHGAA-TGRRPGKLIRGA
Q73RW4_MYCPA/539-587 AAMAFDLPAGGNRILQGASGYAATIVSGTVTRRNDVD-TGARPGRLVRGA
Q7W724_BORPA/522-570 PVMNMDLPAGKGRYLQKPSGYVATIVSGVVVYRDAAA-TGALPGRLVRMA
Q73SY3_MYCPA/520-568 PVISHDLPAGGRRLDQTADGYVATIVSGEIIAENGVP-TAARPGKLVRGR
Q82GU7_STRAW/519-567 ATLVHDLPGDSPRLDSKAIGVTAVWVNGVEAIRDDVV-TGAVPGKVLRSG