EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07882 alignment
(7 sequences with 189 aa)


FUCI_SHIFL/175-355 KSYLSLGGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFR--YGED-ENNKQYQRNAEQS-----RAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQGQRHWTDQYPNGDTAEAILNSSFDWNGVREPFVVATENDSLNGVAMLMGHQLTGT
FUCI_BACTN/173-356 KSYLSMGSVSMGIAGSIVNPDFFQEYLGMRNESIDLTEIIRRMEEGIYDHEEYAKAMAWTEKYCKVNEGEDFKNRPEKRKKREQK-----DADWEFVVKMMIIMRDLMTGNPKLKEMGFKEEALGHNAIAAGFQGQRQWTDFYPNGDYPEALLNTSFDWNGIREAFVVATENDACNGVAMLFGHLLTNR
FUCI_STRR6/173-353 TAYLSMGSVSMGIGGSIVNPDFFQEYLGMRNESVDMTEFTRRMDRGIYDPEEFERALKWVKENVK--EGFD-HNREDLVLSREEK-----DRQWEFVIKMFMIGRDLMVGNPRLAELGFEEEAVGHHALVAGFQGQRQWTDHFPNGDFMETFLNTQFDWNGIRKPFVFATENDSLNGVSMLFNYLLTNT
FUCI_VIBVY/173-351 KSYLSMGSVSMGIAGSIVDQPFFQHYLGMRNEYVDMTEIKRRLDREIFDKEEFELAMAWTKEHCH--EGKD-YNREPMSEARK-------QEDWQTVVKMTMIMRDLMEGNPKLAEMGFGEEALGHNAVVGGFQGQRHWTDHLPNGDFSEAILNSSFDWNGIREPFVIATENDSLNGVNMLFGKMLTGQ
FUCI_HAEIN/178-358 KSYLSIGSVSMGIAGSIVNQAFFQEYLGMRNEYVDMMEIKRRLDRKIYDQEEVDLALSWVKQYCK--EGVD-VNSLENQRNAEER-----AELWENVVKMTIITRDLMVGNPKLATLNYAEEALGHNAIAAGFQGQRHWTDHLPNGDFMEAMLNSTYDWNGVRPPYILATENDSLNAIGMLFGHQLTGK
FUCI_CLOPE/173-359 KSYVNIGASSMGIAGSQVDISFFEDYLGMLVEFVDMTEILRRIHLEIFDPIEYDKALNWIKENCR--EGIDINEGKDLPDIVKKSKVIPADKDWEFIAKQAIIIRDILYRNEKLGDLGWEEEARGRNAIAGGFQGQRQWTDWLPNGDFTEAIMASTFDWNGPRQVTAFATENDTLNGVSMLLGTLLTNK
Q9WYE3_THEMA/160-316 QRYGVFGGRSMGMYTAVPNVDLWNKIFGVDVEHIDQFEIVRRSQ--LIPDERARKGRLWIEEKAKAVH----YDGKYLT-----------PEKLELQIKSYHAVREIVEE----MELDF-----------VGIKGQLELTEHFVTMDVTETFLNDPYDWEGEHEPIVCATEADSDGALTMQIFKLIAKT