EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07878 alignment
(11 sequences with 72 aa)


Q7VEB2_PROMA/12-83 QKSPRVQVVLPEELCAQLTFLAKKESRTVSNMAKVLIQEGVDSLITEYLSKSEESTNTSHTESFRSSLETQQ
Q7V5D3_PROMM/12-82 PKSPRVQVVLPEELCVRLTALAELESRTVSNMAKVLIQQGIQRYEQEQSSV-VSAPSLASTEGFRSALEAQQ
Q7U4A0_SYNPX/12-78 PKSPRIQVVLPEDLCARLTALADQESRTVSNMARVLIQQGV-----QRHEQSAEAPLPSREERLRSALESQQ
Q7V3I9_PROMP/12-82 PKSPRIQVVLPELICEQLNILAENESRTVSNMAKVLIQQGIKNHLK-REAKSQTSDTAVNTENFRDTLERQS
Q7VCC6_PROMA/12-81 SKSTHDAIIDQLRACNTPSEILAFEKWFDNTVNVGPLYTVICDLLRNRSISRCTASKWFET--LLKSRDEKL
Q7TUZ5_PROMM/12-81 SKSTREAIVDKLRACQTDEQLLAYDAQFNIESNTGPLYLVICEFLHNRTISRAIAAKWLRT--LLEDRENKL
Q7U397_PROMP/14-82 NDSSTHALVDVLRKRNTEESILEFEEKFNSRNEKN-LHIYICRFLKNRSISRALASKWLIT--MINDKESKI
Q7V7A3_PROMM/12-81 INRMREAIVDQLRSCSTPEQLLALDEQIRVETDAGPLYRLICNFLRDRTVAPVEAARWLDT--LMDHREKQL
Q7U7V4_SYNPX/2-71 ASDLKERVLSALRACRSSDDLVALDEQLAIDCRDAPLHQVICDALRDRSVAPVEAANWLTT--LMEHRNQQL
Q7U858_SYNPX/9-77 QELQQRLEGQAPAPSSAAVADASSSERINVTLPRGVMDELKRHALEEGRSCGNLAA-YLVEEALRRHRPL--
Q7TV19_PROMM/2-72 AELQERQRFSQEAPSAAMVADSAQSERLNVTLPVGLMNRLKQHALAESRSCSSLAS-FLIEDGLRRHRQLDG