EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07875 alignment
(17 sequences with 65 aa)


Q9KEV6_BACHD/14-78 MTDQVVATDMLIAAKAGIKNIATAISESATPEVRAALQQQLDQQIRFHGQMTEYMMKNGYYHPYN
Q97LE8_CLOAB/14-78 LNDHVVATDFLISTKSGVKNYAVAITETATPRVRAILRKHLDEGINCHEKILNYMMTNGYYHPYN
O06010_BACSU/14-78 LTDQIIAMDLLISAKNGVRNYAMAATEAGTPEVKEVLIRHLEEALDMHEQLSSYMMEKGWYHPWN
O07949_BACSU/17-81 LADTTFAMDFLIRAKEGVRNTAVALTETASPDVRALLRKQLMQGIAMHQEITELMISKKWFHPYE
Q6HGX9_BACHK/76-140 DDTGFYAGDLLGLAKTSVRNYAIAITETATPRLREVLTRQINGAIQLHAQVFNFMYERGYYPAYD
COTF_BACSU/77-141 ADNPFYSGDLLGFAKTSVRSYAIAITETATPQLRNVLVKQLNAAIQLHAQVYRYMYQHGYYPSYN
Q9K644_BACHD/132-196 VSDQGISGHMLGLMKSQATMLTTASLEATNPVVRRVLADSVPNVVEMAYELFLYQNQHAYYQVPQ
Q8ELM4_OCEIH/129-193 LSDQGISAYMLGNAKSLTSLLAMTAVEMTNPVLRRVIADTVPNFIELSYEIFLYQNKHAYYQVPQ
YHCQ_BACSU/120-184 IDDSIISRQMLCAIKAQASMLTMASLEMTNPAVRRVLSAQIQEYVEMAFEIFLYQNKHGYYQVPQ
Q6HJS4_BACHK/81-145 TGDMYIATCYISHLKRLALKFAQVAVEVANPEFRSFLENCFLKMNRYAYSVWQYVVKKEYKIKHV
O69144_CLOPA/101-165 MNDREIATAYLLTLKRAGREYAWSAMETGNPEIRQFLKDAFTMSCNHAYDVWQWMVQKGYYPLSP
Q97FP5_CLOAB/8-72 MTEKDLIEDILSSEKQLISSYSSGITESSCKNLRNVLVNNLKCSEETQYRAFDTMKQKGWYPTKD
Q8R816_THETN/7-71 VTDKEIMMNILGSYKLAIEMLSHAAVEAANESIRREYINLLNSTLEDQRTVWTAVNQRGWYPVKA
Q97FG0_CLOAB/15-79 LTNKDIASDFMMNLDDFIVSLSTATCQTMNPQLRQVFDAQLISAINNQHNLSDMMVKKSWYPAFD
Q8XNS8_CLOPE/1-65 MQEKEMISDYLAGINASLAGYGGIISQCENQELRETIQNMRNQDEVRQYALFKIAKEKGYYIPAQ
Q8ES15_OCEIH/2-66 LQDKDIVNDYLNGLNASMKSYAGYITEANNPELRQKLVSLRNGDEARQLSVYQYAIQKGHYKPAQ
Q6HBQ7_BACHK/1-65 MNEKDMVNDYLAGLNASLTSYANYIAQSDNEQLHQTLIQIRNQDEMRQRNMYEYAKQKSYYKPAA