EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07858 alignment
(7 sequences with 127 aa)


LIMA_RHOER/21-144 TPDEKIVLEFMDALTSNDAAKLIEYFAEDT-MYQNMPLPPAYGRDAVEQTLAGL--FTVMSIDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNLSILGVFQLTEGKITGWRDYFDLREFEEAVDL
Q9A482_CAUCR/6-128 PSPAQVVRAFMKAMERLDYDAAVQHLAPACEYTNPPPIGTVHGPAGVRAVLEPF--FAPTLENEFRILREATDGGLVFHERLDRHRLKDG--WVELPVTGVYEVVDGKIAYWRDYFDAQTILSQWPR
Q73W09_MYCPA/9-129 VANTRTVEGFLNALQDADYDAAEAALADDL-VYENVGLPTIHGRARAMKLFRRM---EDRAAFEVKIHRIAADGGAVLTERTDALIF--GPLRLQFWVCGVFEVQNGRITLWRDYFDFFDMLKATAR
O33283_MYCTU/15-135 TEAIRAVEAFLNALQNEDFDTVDAALGDDL-VYENVGFSRIRGGRRTATLLRRM---QGRVGFEVKIHRIGADGAAVLTERTDALII--GPLRVQFWVCGVFEVDDGRITLWRDYFDVYDMFKGLLR
Q49850_MYCLE/43-164 VENIRTVEVFLAALQDAGLRNRIRDVGRQPRVYQNVGLPTIHGRSKTITLWRKM---ADCIGFEIKIHRIAAVAIAVLCERADAVIV--GPLWMQFWVCGTFEVQNKRIMLWRNYFDLFDLFKATMR
Q8XW86_RALSO/2-128 STPIEIVTAFCATFPEDDGKAAIRRYFTPDTVWINEGISKTTGIEEAIAFLGRPNRSPSIAAVHFDILAIAADGNRVLTERLDRFVRADGSEIAAIRVMGIFEVEGDRIVAWRDYADVNAGRKITPD
Q8XW85_RALSO/2-128 PTPLETVSHFCAAFVEDGGRPAVRRWFTPDTRWVNEGVSATTGVDEAIAMIDGLETSMGISTVHFDVIAIAADGSRVLTERVDRFERADGAEIGRVTLMGIFKVEGEKIVEWRDYFDVNALQAFNAG