EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07835 alignment
(7 sequences with 48 aa)


Q9A398_CAUCR/5-45 YH-------RGEMDIQEQAATYDAFGKMTKWGSLAISVLLLFFTLLFC
Q8KRK5_RHOSH/14-61 HSHPAHGHVAGSMDITQQEKTFAGFVRMVTWAAVVIVAALIFLALANA
COX4_PARDE/3-49 HH-EITDHKHGEMDIRHQQATFAGFIKGATWVSILSIAVLVFLALANS
Q92LZ6_RHIME/4-50 HH-SGPVETGAPMDYSEHEKTYDFFISATKYGTLFCVALLIAMAAAFF
Q8U4V6_AGRT5/129-175 HH-TGPVEVGAEMNYAEHEKTYNGFLAMTKYGTMLLCVLMLAMVAGFF
Q8FV73_BRUSU/4-51 HHTTAPAELGAPMDYAEHEKTYAGFAGLVKWATVVLVALMIAMAFGFF
Q6N267_RHOPA/4-50 HH-EFAYTTADGNDYAAHEQTYEGFIKLVKYGTAAVIVIVALMGIFLT