EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07830 alignment
(6 sequences with 84 aa)


Q8IMK7_DROME/278-356 SIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIE----SSKITDYVDLLKCLQNRD-DIEGLPPGGGLQSKYHVIERTFKQ
Q7Q414_ANOGA/277-354 SIIIIAFPGAPPVSEEAQKREEALEQHLRARIEQILG----EMSSIEYGALLKELARE--DIPDLPPGGGLHAKCSYVSKVFKE
P2CA_BOVIN/285-364 SVILICFPNAPKVSPEAVKKEEELDKYLESRVEEIIK--KQGEGVPDLVHVMRTLASE--NIPSLPPGGELASKRNVIEAVYNR
Q6NY18_BRARE/323-404 TIIIICFDGAPKVTQEALQQEAELEQLIEQKVAEIIHVIRSKDEEPDLLYVMKFLASE--PIPGLPPGGGVSCKRDCIIAAYQK
Q6P662_HUMAN/2-80 TCILVCFPGAPRPSEEAIRRELALDAALGCRIAELCA---SAQKPPSLNTVFRTLASE--DIPDLPPGGGLDCKATVIAEVYSQ
Q9VBF9_DROME/277-356 TLLLLLLPGAPKVDMDAVKAERSLDQTIVQITKEVIE----KHEIHDFETLIRLMKRMAINIPNLPPGGGLYAKYYIIEQAFHE