EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07810 alignment
(14 sequences with 116 aa)


Q9VT17_DROME/1138-1253 CWETSLGQELSKVIVFDGLMSIVAPLCIDFLRALFVRYVNQNWCWDMEKTFPQYGDFKIAENILTLINNQGQVWMGIFFSPGLVLINLVKLMIMMYFRSWIVLTCNVPHEVVFKAS
YT41_CAEEL/594-709 CWETIIGQEITKLVTMDLYMTVASIFLIDFLRGLACRYLNLYWPWDLERTFPEYGEFKVAENVLHLVNNQGMIWLGLFFVPLLPMLNNIKLIILMYIRGWAAMTCNVPASQIFRAS
Q7TN62_MOUSE/457-567 CWETRLGQEMYKLVLFDLLMGLLVTLLVQFPRKILCGLCPGA-L----GRLSGTLEFQVPDEVLGLIYAQTVVWVGSFFCPLLPLINTAKFLILFCLKKITLFSIYSPASRTFRAS
Q7T1T6_FUGRU/445-555 CWETRVGQEMYKLTVFDLLVTIATLVLVEFPRRMLVDNWSNK-L----VQKLGRQEFVVPANVLVLVYGQTVVWTGALFCPLLPLINTVKFIILFYCKKITLFCNCRPALRTFRST
Q7TN59_MOUSE/484-595 CWETQVGQEMYKLMIFDFIIILAVTLFVDFPRKLLVTYCASSKL----IQCWGQQEFAIPDNVLGIVYGQTICWIGAFFSPLLPAIATLKFVIIFYVKELSLLYTCRPSPRQFRAS
Q7T1T7_FUGRU/456-566 CWETRVGQEMYKLTIFDFIIIAAATISVEFPRKLIVRHCDCG-L----AKWWGQQEFAIPQNVLEIVYGQTICWIGTFYSPMLPAICTIKYFFIFYIKKVSLINNCRPATRPFRAS
Q6NUU5_BRARE/502-612 CWETHVGQEMYKLVIFDLLIVAAVTVFVEFPRKMVVQHWRCG-V----TQWLGQQEFSVPQNVLEMVYGQTICWIGAFYCPLLPAINTVKYMLVFYLKKVSLVTNCRPSTRPFRAS
Q7TN58_MOUSE/422-532 CWENSVGEELYKLIIFNFLLTVAFAFLVSLPRRLLVERFSGW-F----WTWLDREEFLVPKNVLDIVAAQTVTWMGLFYCPLLPLLNSVFLFLTFYIKKYTLLRNSRASPRRFRAS
Q7PZP5_ANOGA/338-448 CWETFVGQQFYKLFIVDFATHFLVTFFVNFPRALFARHSSSR-L----AKFIGEQEFELSKHVLDVIYSQTLCWLGTFYAPFLPAIAALLTFLMFYIKKFACLVNSNPSAILYRAS
Q7T1U0_FUGRU/540-646 CWESYVGQELYRFLIMEFIFTLLDTLFGELLWRLFSERV---------LRRRRRPVFDIARNVLELIYGQTLAWLGVLFTPLLPAVQILKLLLLFYIKKSSVMMNCQAPRKPYRVS
O43284_HUMAN/179-285 CWEDFVGQELYRFLVMDFVLMLLDTLFGELVWRIISEKK---------LKRRRKPEFDIARNVLELIYGQTLTWLGVLFSPLLPAVQIIKLLLVFYVKKTSLLANCQAPRRPWLAS
Q7T1T9_FUGRU/475-577 CWESFVGQELYRLLLVDFVFTALHTFLGEFLWGQL-------------LKRRRKPGFDIARNVLELIYGQTLTWFGVLFAPLLPAVQIIKLIVLFYLKKSGVLLNCQAPRKPWRAN
Q7T1T8_FUGRU/369-471 CWESMVGQALYRLVFFDFLFLLLGSFFGEFLSKWL-------------LPSLGVPEFDVARNVFELIYAQTLSWIGIYFSPLLPAIQILKCFILFYVKKVSLAQNCQPPQRTGRAA
Q6UXY8_HUMAN/724-830 CWETLIGQDIYRLLLMDFVFSLVNSFLGEFLRRIIGMQL---------ITSLGLQEFDIARNVLELIYAQTLVWIGIFFCPLLPFIQMIMLFIMFYSKNISLMMNFQPPSKAWRAS