EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07764 alignment
(2 sequences with 71 aa)


Q83WL2_9ZZZZ/1-71 MIVGNLGAQKEKRNDTPISAKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMEIRLRSKLKSVLIVHY
Q57468_STRPY/1-71 MIVGNLGAQKAKRNDTPISAKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL