EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07763 alignment
(5 sequences with 273 aa)


Q6PBT3_BRARE/60-301 SMEDLVNEFDEKLNVCFHNYNTKTEGLAPVRNQSHAEEDEERLQDEDVWDALTDNYMPSSVSSWDDPTSETLNGNLSDQEIH-------------EKDED-EMNEKNENANCL----------NEEPLITADQVIEEIVEMMENSPDPGETEEE-EEDDIGVSSSKSSPSLLEEIR------MLSQASNNNCSYEGLRLMPSSALLDILCRMEAAIREYSEELVAQLARRDELEFEKEVKNTFITALMEVQNRQKEQRELSKRRRKDKAMSLQ
FEZ1_RAT/58-301 SMEDLVNEFDEKLNVCFRNYNAKTENLAPVKNQLQIQEEEETLRDEEVWDALTDNYIPSLSEDWRDPNIEALNGNSSDTEIH-------------EKEEEDEFIEKSENDSGI----------NEEPLLTADQVIEEIEEMMQNSPDPEEEVEVLEEEDGGEISSQADSVLLQEMQ------ALTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEELVHQLARRDELEFEKEVKNSFITVLIEVQNKQKEQRELMKKRRKEKGLSLQ
Q6P395_MOUSE/33-275 SFPALASSLEEKLSLCFRPT-SEAE---PPRAAVRPITECSLLQGDEIWNALTDNYGNVMPVDWKSSHTRTLHLLTLNLSEK----GMNDGLLFDASDEE-ELREQLDMHSII------VSCVNEEPLFTADQVIEEIEEMMQESPDPEDDETP--------TQSDRLSMLSQEIQ------TLKRS-SMSSYEERVKRLSVSELNELLEEIEAAIKQYSEELVQQLALRDELEFEKEVENSFISALIEVQNKQKEHKETAKKKKKLKSGSSQ
O01392_CAEEL/61-327 SLEDLVGNFDEKIAACLKDHEVTTADIAPVQIRTQ----EEVMNESQTWWTLTGNFGNIQPLDFGTSSICKKMAAALDSDSLKDDASTRRSMTN-SDDED-LLRQQMDVHQMIGHHHGSTDTGGETPPQTADQVIEEIDEMLQSCDFTGSMMTDRTMESVDSMYSSMRSPFPSSIQSSDADIKLRSAQALVSNPDNLQELSYSKLVTLCAEMEQLIRVYNESLVDELAHRDELDYEKEMKNSFISLLLAIQNKRRVYANDRKRKVGKASDASQ
Q7QD97_ANOGA/14-252 SLEDLVNTFDEKITKCFGNYEQSVEELAPVQVRSQ----EEIMNECQMWWTITGNFGNILPIDWSKTYARQMHVPALNLGMR-KPGTPDDELLQDLSSEDEAVASDLDMHALI---LGGLHADNE-PIKTADEVIKEIDDIMDE---TGSEDGQLENEVIEKAKEVLGSPL---------------------YEEKLRSLSITQLNELYMEMEVLIREFSETLISELALRDELEYEKELKNTFISLLLAVQNRRRQYH-VEKKKGKAGGKGSA