EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07707 alignment
(88 sequences with 108 aa)


Q9W6R3_FUGRU/76-178 CIDIYQLTKYN.FCTQLEQKAYKFILNNFDLIESGE.EFFQ.LDMEHFCSIIASDHLCVSSEAVVFRAVVRWINHAVADRKEFTAILF.SKVRL.CFLSYEYIRLNML
Q9W6R2_FUGRU/75-177 CIGIWQFSDIC.YCSQLQEKAFEFILCNFDQVISSK.EFHQ.LSVEELCDIFDHDELNVKNESIVFEAICKWISHNSERRKRHFAILL.PKVRL.ALLSLEYIITNMV
Q9VK21_DROME/187-289 ALGILRFAEAH.NCESLAKSALNFVHANFPAVTLED.EFLE.TPQTLLSQLLNSELLRVDSESQVFQAALRWIKHDVTQRRCYVFDVL.SHVRM.ALVPVKVIDKALK
Q7PMB5_ANOGA/142-244 ALGILRFAEAH.NCRQLAEVAANFVHSNFPKVALED.ELLD.IPHTLLVKVIASEALRVDSEYQVFNAALRWIRHDVVPRRQYVFEIL.SHVRI.ALVPVGLIDQAIA
Q6GNZ5_XENLA/139-241 CIGFFQFAEHL.ACHPLLEFTESYIHTHFTEVQTGD.EFPT.LTKDQLVQILQNEELCIEDEYQVFSAAMTWIQKDIVTRKRHVIEVL.EPVRF.SLLPPKRLQKAIE
IPP_MOUSE/139-241 CIGLFQFSEQI.ACHDLLEFTENYIHSIFLEVHTGE.EFLG.LTKDQLIKILRSEELSIEDEYQVFLAAMQWILKDLGKRRKHVVEVL.DPVRF.PLLPSQRLLKYIE
Q9VGE5_DROME/143-245 VLGIRTFADSM.ICRQLIDAADKYIDQNFAKVSQSE.EFLA.LDCEQLLELMRRDELNVRTEEVIFEACMKWVKYAEDKRSELFPQVL.AAVRL.PLLSPQFLADRVA
Q7QHD7_ANOGA/142-244 VLGIRQFADTL.GCSKLIVSADRYIHQHFSKVAAGD.EFVA.LSYSELIDVIGRDELNVKSEECIFEACMRWVKHEQETRSEYLPLIL.ANIRL.PLLSPQFLADSVA
Q6IQ87_BRARE/140-242 CLGVRQFAETM.MCTTLYDAANSFVHQHFVEVSVSE.EFLA.LRPEEVLELVGCDELNVQAEEQVFEAVLAWVRHERDDRESRLPELL.SKIRL.PLCRPQFLADRVQ
KLH18_HUMAN/75-177 CLGVRQFAETM.MCAVLYDAANSFIHQHFVEVSMSE.EFLA.LPLEDVLELVSRDELNVKSEEQVFEAALAWVRYDREQRGPYLPELL.SNIRL.PLCRPQFLSDRVQ
Q8N4I8_HUMAN/152-254 CLGIRAFADVH.TCTDLLQQANAYAEQHFPEVMLGE.EFLS.LSLDQVCSLISSDKLTVSSEEKVFEAVISWINYEKETRLEHMAKLM.EHVRL.PLLPRDYLVQTVE
KLHL2_HUMAN/158-260 CLGIRAFADMH.ACTDLLNKANTYAEQHFADVVLSE.EFLN.LGIEQVCSLISSDKLTISSEEKVFEAVIAWVNHDKDVRQEFMARLM.EHVRL.PLLPREYLVQRVE
KELC_ANOST/201-303 CLGIRDFADIH.GCIDLLNYAETYIEQHFSEVVQFD.EFLN.LTSDQVAHLIKSDRLSVPTEEKVYECVITWIQYDVNGRQHHLAELM.EHVRL.PLLSQDYLVQYVE
KELC_DROME/258-360 CLGIREFADIH.ACVELLNYAETYIEQHFNEVIQFD.EFLN.LSHEQVISLIGNDRISVPNEERVYECVIAWLRYDVPMREQFTSLLM.EHVRL.PFLSKEYITQRVD
KLH17_MOUSE/192-294 CLGIRGFADTH.SCSDLLKAAHRYVLQHFVDVAKTE.EFML.LPLKQVLELVSSDSLNVPSEEDVYRAVLSWVKHDVDTRRQHVPRLM.KCVRL.PLLSRDFLLGHVD
Q7Q1T2_ANOGA/174-276 CLGIRSFADAH.SCKELHSRSHRYALQNFQQVVGTE.EFLL.LGFNEVQDLISNSQLNICSEEKVFMAVLNWVKHDLSERKKHISELM.SHVRL.PLVSREFLMNCVE
Q6DFF6_XENLA/165-267 CLGIRAFADTH.SCRELLRIADKFTQHNFQEVMESE.EFML.LPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVL.QHVRL.PLLSPKFLVGTVG
O61795_CAEEL/158-260 CLGIRAFADTH.SCKELLSSADEFALKNFSRVIGKE.EFQM.LTVESLTTIIKSDKLNAASEELVFSAVIQWVRHDISKRKTHLSMLL.SHVRL.PLCTPKFLVSVVS
Q6NRH0_XENLA/125-227 CLGIRDFAETH.NCLELMQAAEVYSQKHFPEVVQHE.EFML.LHQEEVEKLIHCDEIQINSEEPVFEAVINWVKHNRHEREKSLPQLL.QYVRM.PLLTPRYITDVID
BTBD5_MOUSE/137-239 CIGISRFAETY.GCHDLYLAATKFICQNFESVCQTE.EFFE.LTHADLDEIVSNDCLNVATEETVFYALESWIKYDVQERQKYLAQLL.NSVRL.PLLSVKFLTRLYE
Q8CCY1_MOUSE/317-418 CLGIRAFADAQ.GCIELMKVAHSYTMENIMEVIRNQ.EFLL.LPAEELHKLLASDDVNVPDEETIFHALMMWVKYDMQRRCSDLSMLL.AFIRL.PLLPPQILAD-LE
Q6PFE1_MOUSE/275-376 CLGIRSFADAQ.GCTDLHKVAHNYTMEHFMEVIRNQ.EFVL.LPANEIAKLLASDDMNIPNEETILNALLTWVRHDLEQRRKDLSRLL.AYIRL.PLLAPQFLAD-ME
Q6PGA3_MOUSE/223-324 CLGIRSFGDAQ.GCMELQNVAHKYAMEHFIDVIKNQ.EFLL.LPANEISKLLCSDDINVPDEETIFHALMQWVGHDAQARQRDLAKLL.SYIRL.PLLSPQLLAD-LE
Q86BQ6_DROME/179-281 CLGFAFFAEQQ.SCTTLLRLAQAYTCQYFMQVCQNQ.EFFQ.LNADQLGKLLSSDDLNVPSEQDVFHSLMSWVRHDSAAREQHIPELL.ALVRL.PLLQPAFIMDHVE
Q7PXP7_ANOGA/216-318 CLGFSLFAEQQ.GCTALLKLATAYTCQHFQQVWKNQ.EFFM.LDAAQLANLLRSDDLNVPNEQEVFHALMAWIQYDAEGRKRHIPELL.ALIKL.PLLQPSFIVDHVE
Q8AW66_BRARE/167-269 CVGILHLADVH.SLESLKTQVHSYIVQNFSQVVDHE.EILE.LPADVLVSLIQHDDLGVTEEEQVFDTVIRWVKAREDDRTALLPRVL.THVRL.PLLDPWFFVERVE
KLHL6_MOUSE/163-265 CIGILRLADTH.SLDSLKMQVQSCIIQNFVQILNSE.EFLE.LPVDTLYHILRSDDLCVTEEAQVFETVMSWVRHKQSERLCLLPCVL.ENVRL.PLLDPWYFVEMVE
Q7SYC4_BRARE/168-270 CLGIQRFADAH.SLKQLASRCRSYALQSFADVAQHE.EFLD.LRKEELEEYIASDEMVIGKEETVFEAVMRWVYYDVDHRRIMLKDLL.NHVRL.PLLHPNYFVQTVE
Q6NRT8_XENLA/167-269 CLGIQHFADTH.SLKTLFTKCKSFAQQAFEDVVQHE.EFLE.LGKAELIDYICTDELVVSKEEMVFEAVMRWVYHHVDVRRPMLQELL.THVRL.PLLHPNYFVQTVE
Q6PF15_HUMAN/9-111 SLALRRVAAAF.SLAPLAERCGRVLRQAFAEVARHA.DFLE.LAPDEVVALLADPALGVAREEAVFEAAMRWVRHDAPARRGQLRRLL.EHVRL.PLLAPAYFLEKVE
Q18670_CAEEL/173-275 CVGMAEFARAH.ACHQLAHAAQLYTRQHFVEIIDNE.ELLS.LDKDAFCELIQDDRITVPSEKPVMQAVLNWVAHEEPSRRPFLAELM.SNVRL.PLLGDDYLFEKWR
Q8JIM0_BRARE/160-262 VIGISRFAEEI.GCTDLHLRTREYINTHFNEVTKEE.EFFS.LSHCQLLELISQDSLKVLCESEVYKACIDWVRWDAESRAQYFHALL.NAVHI.YALPPTFLKRQLQ
KEAP1_RAT/184-286 AIGIANFAEQI.GCTELHQRAREYIYMHFGEVAKQE.EFFN.LSHCQLATLISRDDLNVRCESEVFHACIDWVKYDCPQRRFYVQALL.RAVRC.HALTPRFLQTQLQ
Q7KSF5_DROME/192-294 AIGIAHFAEQH.GCVELQKKANVFIERNFTQVCQEE.EFLQ.LSAYQLIALIRRDELNVQEEREVYNAVLKWVKYDEDNRHCKMEHIL.GAVRC.QFLTPNFLKEQMK
Q7QAK9_ANOGA/104-206 AIGIANFAEQH.GCESLRQKANQFIERNFTQICREE.EFLQ.LSVMQLICLIRKDELNVQGERDVYDAVLKWVKYDEDNRYPKMESIL.SAVRC.QLLTPSFLKEQMK
Q6DJ21_XENTR/98-200 CLGISVLAECL.DCPELKATADDFIHQHFTEVYKTD.EFLQ.LDVKRVTHLLNQDTLTVRAEDQVYDAAVRWLKYDEPNRQPYMVDIL.AKVRF.PLISKNFLSKTVQ
Q8R2P1_MOUSE/149-251 CLGMMVLSDAH.QCRRLYEFSCRMSLVHFETVRQSE.DFNS.LSRDTLLDLISRDELETEDERVVFEAILQWVKHDLEQRKAHLPLLL.RNVRL.ALLPSDCLKNAVS
Q6DFF7_XENLA/149-251 CLGMMILSDAH.QCQRLYELSLRMCLSNFATLHNTE.DFSS.LSKDMLLDLISSDELEIEDEQVVFNAVLHWVKEDLDKRKDYFPELL.RNVRL.ALLPSELLKEAVV
Q6TEQ2_BRARE/149-251 CLGMMLLSDAH.QCQRLYELSWRMCLANFANLYHTE.DFLS.LPKDKVQELVFSEELEVEDESIVYEAVIDWVRADIGRRHLDLPDLL.RCVRL.ALLPETYLLKTWH
Q6GNW3_XENLA/149-250 CLNMMLISDAH.CCERLLELSWRMCLSNFVELSNTE.DFFR.LPKLKLMELVLSEELEVEDESLVYEAVMGWIKFDLSIRLDDLPDLL.RYVRL.ALLPDQYL-RCLA
ENC1_HUMAN/149-251 CLGMLLLSDAH.QCTKLYELSWRMCLSNFQTIRKNE.DFLQ.LPQDMVVQLLSSEELETEDERLVYESAINWISYDLKKRYCYLPELL.QTVRL.ALLPAIYLMENVA
Q8BSF5_MOUSE/136-237 CLGLVRLAEIL.SCDSLKKKAKEVALTYFPEVAASA.DLKE.LCAMELRDYLGDDRL-CGEEEKVFEALMAWVKHDLQARWRHMQELL.QQVRL.QYIHPAFFHHFIA
KBTB9_MOUSE/216-318 CLGVLAMAEAM.QCSELYHMAKAFALQIFPEVAAQE.EILS.ISKDDFIAYVSNDSLNTKAEELVYETVIKWIKKDPATRAQYAAELL.AAVRL.PFIHPSYLLNVVD
Q6NYM1_BRARE/140-242 CLEIQDFAEAY.ACRELAASARRFVLKNIVELAKSM.DFER.LSWKRLLEFVSDDGLCVDKEETAYQIAVRWVKADLQHRLHYWPELL.QQVRL.PFVRRFYLLAHVE
Q5SY28_HUMAN/138-239 CLDMQDFAEAF.SCSGLASAAQRFILRHVGELG-AE.QLER.LPLARLLRYLRDDGLCVPKEEAAYQLALRWVRADPPRRAAHWPQLL.EAVRL.PFVRRFYLLAHVE
KLHL8_MOUSE/178-280 CLAVRAFAESH.NRIDLMDMADQYACEHFTEVVECE.DFVS.VSPQHLHKLLSSSDLNIDSEKQVYSAAIKWLLANPQHHPKWLDETL.AQVRL.PLLPVDFLMGVVA
O18147_CAEEL/153-255 ALSIREFCKMMcVEEKITEMTDDYIQKHFMAVSKDE.DFKR.LSLEDAIELLRNDHLYVDSEEQVYVAAMEWLNCDVI-RHEQAAKIL.PCVRL.PLLSPTYLSSIVA
Q7SYD2_BRARE/136-238 CLAVFRLGLVL.SVPRLAIAARDFIADRFETVSSEE.EFLQ.LAPHELSALIGGDMLNVEKEEVVFESVMKWVRNDKANRVKSLAEAF.DCIRF.RLLPEKYFREKVE
Q6P4N4_XENTR/135-237 CLAIFRLGLLL.DCPRLAVTARDYVCDRFMQICNEE.DFLQ.LAPHELIAVISSDGLNVEKEELVFEAVMKWVQTDKENKTKSLSDVF.DCIRF.RLMPEKYFTDKVE
KBTBA_HUMAN/135-237 CLAILRLGLLL.DCPRLAISAREFVSDRFVQICKEE.DFMQ.LSPQELISVISNDSLNVEKEEAVFEAVMKWVRTDKENRVKNLSEVF.DCIRF.RLMTEKYFKDHVE
Q6ZUS1_HUMAN/117-219 CLGICEFGEQQ.GLLGVAAKAWAFLRENFEAVARED.EFLQ.LPRERLVTCLAGDLLQVQPEQGRLEALMRWVRHDPQARAVHLPELL.SLVHL.DAVPRPCVQQLLA
Q6INL2_XENLA/135-237 CLGIWEFGETH.GCPEVAAKALSFLQENFEAVSQEE.EFLL.LSPERMLCYLGDPLLQVRDEQSRAKAALHWVKQDKECRAQCLPQLL.SVAQL.SSLTDQYLQELME
Q9D618_MOUSE/131-233 CIGIYYFAKQI.GAEDLSDQSKKYLYQHFAEVSLHG.EILD.IEAHQLLALIKSDDLNISREESILDLVLRWVNHNQALRTEHLVELL.KQVRL.ELINASFLRQALR
Q8NFY9_HUMAN/126-229 SIGVFIFADHY.GHQELGDRSKEYIRKKFLCVTKEQ.EFLQ.LTKDQLISILDSDDLNVDREEHVYESIIRWFEHEQNEREVHLPEIFaKCIRF.PLMEDTFIEKIPP
Q6N066_HUMAN/154-256 CLQLLSISDSY.GSTSLFDHALHFVQHHFSLLFKSS.DFLE.MNFGVLQKCLESDELNVPEEEMVLKVVLSWTKHNLESRQKYLPHLI.EKVRL.HQLSEETLQDCLF
Q6IR89_XENLA/133-234 CVRLLSFADLF.SCEELKQSAKRMVEHKFTTVYHQE.AFMQ.LSSELLIELVSSDNLNVEKEETVREAAMSWLDYNTVSRSQYLSTVL.SHLRI.DALS-EVIQREWF
Q8CA72_MOUSE/133-235 CIGIRDFALHY.CLHHVHYLATEYLETHFRDVSSTE.EFLE.LSPQKLKEVISLEKLNVGNERYVFEAVIRWIAHDVEMRKVHMKDVM.SALWV.SGLDSSYLREQML
Q6GQU2_MOUSE/139-240 CIGMHSFAEFH.VCSELEKESRRILCSRFKEVWQQE.EFLE.ISLEKFLFILSRKNLSVWKEEAILEPVIKWTAHDVENRIECIYNLL.SYINI.D-IDPVYLKTALG
Q7ZVF7_BRARE/174-276 CVAIHSLAHMY.TLDQLALRAVDMIRRNFHKVIQDE.EFYT.LPFRLVRDWLSDAEITVDSEEVLFDAVVKWVQKNSEERVKYFEELF.RLLRL.PQIKPTYLTRVVK
Q6GKZ1_DROME/195-298 CVSIMGFARFR.FLEDLHLKARNYTLRYFTEVAYRNiDILD.MSAEDFYSIISDDELNTREEDHVWKLCVKWIDRNPESRKRHVAHLM.TGVRL.GLMTPKCFMEEVK
P87597_COWPX/101-204 CLDIITYAAFY.NLEDLKIAAINTTATNFTHVVKDD.TFLS.LPFDIISSIFENDDLNTKSEDEAMDALCIWMKDDAE-RINMVKENIsKLIRVdELLSKKYILNELG
Q8N4N3_HUMAN/148-250 YLYLQELASIY.SLKRLDAFIDGFILNHFGTLSFTP.DFLQnVSMQKLCVYLSSSEVQRECEHDLLQAALQWLTQQPE-REAHARQVL.ENIHF.PLIPKNDLLHRVK
Q6KAS2_MOUSE/175-277 YLYLQELASIY.SLKRLDAFIDSFVLSHFSTLSFTP.DFLQsISVQKLCVYLSSGQVQHKWEYDLLQVALQWLTQQPE-REVHTRRVL.ENIRF.PLFPEDILLQRVK
Q8BWA5_MOUSE/172-273 CMYVVNIAETY.SLKNAKATAQKFIRDNFIEFAESE.QFMK.LTFEQINELLVDDDLQLPSELVAFQIAMKWLEFDQK-RVKHAADLL.SNIRF.GTISAQDLVNYVQ
Q6Q7X9_BRARE/173-274 CMYVVNIADTY.NLKETKEAAQKFMRENFIEFSEME.QFLK.LTYEQINEFLTDDSLQLPSELTAFQIAVKWLDFDEK-RLKYAPDLL.SNIRF.GTITPQDLVSHVQ
Q8BGY4_MOUSE/156-257 CLHIGQMATTF.SLTSLRESVDAFTFRHFLQIAAEE.DFLR.LPLERLVFFLQSNRLQSCAEIDLFRAAVRWLQHDPA-RRARASLVL.RHVRF.PLMQPAELVDSVQ
Q6DE07_XENLA/176-277 CVEVGRIANTY.NLTEVDKYVNNFILKNFPALLTTG.EFVK.LPFDRLAFVLSSNSLKQCTELELFKAACRWLRYEDT-RMDYAAKIM.KNIRF.PLMTPQDLINHVQ
Q9W2S3_DROME/150-248 VCMILDAARLY.NLEELTEVCLMFMDRNAGDLLLHN.SFNT.LSKESLEEVLRRDCF-FAPEVQIFLAVWKWSRFNSN---VDFKSVV.SYVRL.PLMNLEHLLQVVR
Q7QI84_ANOGA/148-248 VCAILDAARLF.ALDGLTAVCHSFMDRNAADILQHE.SFRH.LSLDSLCSLLLRDSF-FAREVEIFQAVFDWCRCNAD-TVPNVDVVV.GKVRF.ELMSLEELLTVVR
Q7QIC9_ANOGA/141-242 VCAILDAGRLF.DLADLLAVCDEFVDRNALAVLRHE.TFQN.LTFESLCRLLDRDKF-DAPEVDIFLAVHKWYRAKEDADADQYKKIY.DKVRF.PLMSHNELVTVVR
Q8C2V5_MOUSE/142-240 VCMTFDVASLY.SLPKLTCMCCMFMDRNAQEVLASD.GFLS.LSKTALLNIVLRDSF-AAPEKDIFLALLNWCKHN---AKENHAEIM.QAVRL.PLMSLTELLNVVR
Q6GML3_BRARE/142-241 VCLVFDVASLY.CLNGLAEACMAYMDRNAVEVLKSD.GFLT.LSKSALLTVVRRDSF-ASSEREIFQALCHWCHHNG--DGPEAKEVM.SAVRL.PLMTLSEMLNVVR
O16313_CAEEL/170-270 LCSIFNAAYFF.QFTDLIDYCMQYSDKHADQLLEDP.SFNR.LSGDSLKELLARDSF-FALELKIFNAVRSWHQNNPT-MKEASKVLL.ELVRL.PLITQTELLNCVR
Q9W4S3_DROME/306-407 AFQAYIMAKDY.RCPEIMIVMQSRLRKCFLPIVASW.EFLE.FDVNEVTTLLEQDMLCVNSEDEIFFAVFHWLNYSWTERKKHAVKVM.QKVRF.GLLSP-WLRRSIC
Q9V755_DROME/214-317 ACVLYVESKDNpAMDVVRNLMLTRIRKFLLTFVATR.DFLD.LPTSHLIFLLESDQICVNTEIEVFFIAVRWLGHDWNKRKVHVRRLM.SCIRF.NLMPLWYLLYARR
Q8IH95_DROME/224-325 AAMLYFEAKIL.KLEVIHLQYLERVSKFFLTLVASK.EFLR.LPLKSMLLLIQSDLIGVNTELEVFMAAARWLSHHWPQREENVTDVV.SSIRF.GLIPPWLLIR-LQ
Q9W4L5_DROME/162-265 AFQVYLRALKYpQLEELRKLMLQRIGAAFLAVLGGD.DFQR.MPLEDVITMLQQDSLGVNSEMEVLVAIIRWLNCQSKCIDQATPLLM.DCLRL.TLLPLPILKRFWR
Q9Q8G2_9POXV/125-224 CLHYYEFSKRY.NRRHIFNVVITTIIHNIVSVLRQP.NFKT.IELCDLQNILSSDDLNVIDEDVCAVVLVTWLKQN--NMEDCPSVLL.EQVRM.SLLSMS-VKNLLL
Q8V3G0_SWPV/125-224 CLQVYMFSKVH.NLFRLMDVALSTIIMNITTIYKHD.NFGL.LDEKDIELILGSDYLNIIDEDISVVILFNWLRYN--NVTRCPLSIL.AKIRL.SLLSNQ-VSKFIH
Q9DHH3_YLDV/126-228 CLRMYYYAKKF.CRKELENVAMEMIIKNILKIVSRP.EFNS.ICISDLKIILSNEKLNVIDEDLAAYILSKWLNKNKNTVKKCPLSLL.KTIKK.SLLCEKMIELLLN
O72736_COWPX/123-222 CIDFYIYADKY.NNKKIESASFNTILRNILRLINDE.NFKY.LTEESMIKILSDDMLNIKNEDFAPLILIKWLEST---QQSCTVELL.RCLRI.SLLSPQVIKSLYS
Q8JTN6_LSDV/122-221 CLDACIFSEFY.NLKKLNKFTYKFIRKNIRKIYLKK.DFIY.LSFNVIDLLLRDKKTVFYNEDDVLCIILQWLNNEA--NNKYFHDVL.KVIRF.SLLSEECADK-LK
Q8JTM8_LSDV/120-221 CIEIYKFSQYY.GYKKLSSYTYDYIRCYIESIYNQN.EFTT.LTINDIMKLLSDRKTIVASENSVVEILVSWLTSQNSISCFEICKIL.KLIKI.PFVTEEYFKK-LQ
O72746_COWPX/102-200 CLEIYRITNIN.ALSYIYNDVRNFILDNILLIYKDP.DFIY.LPKYIIIDLLSDDHLNVFNEDNVIKIIYTYISSD---IYKDISDIL.PVIRW.NYLSPEWLTD-ME
Q8JU17_LSDV/121-220 CVDIFRRSYMY.GCYDVYDVADKYIKKRFMYIS--N.DLTK.LRVNELRPILKSSDLVVDTEDFVLNFIIKWGTVKKTNRLNTMKLVN.DSVRF.TFLTEKG-KKRLR
Q9DB72_MOUSE/169-269 AVGWYHYAVST.GDEALRESCLQFLAWNLSAVAGSA.EWGA.VSPELLAQLLQRSDLVLQDELELFHALEAWLGRARP-PPTVAERAL.RAIRY.PMIPPAQLFQ-LQ
Q6AX46_XENLA/177-277 VVSWYHYALRM.GDITLQESCLKFLAWNLSTVMSSN.EWVT.VSDNLMVSLLQRSDLVLQSELELFNAVEEWVSKKNP-DVPVIEKVL.RAIRY.PMITPSQLFQ-IQ
Q8IQ29_DROME/76-176 CLAIAGMADIY.GIMDLSERAYRYMCAHFEEFATTS.DFKE.MKVDQLRFILSSNYPIDVAEQDLVRLVCSFAIEQQL-NESALGDLL.RLIKW.QHISYKSVDE-LR