EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07700 alignment
(16 sequences with 176 aa)


Q9VEU5_DROME/1-170 MYGMLYESVQHYIQQEYGMETWRKVCQIVDCK-HQSFKTHQIYPDKLMPDFAAALSASTGESFDFCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDN-IHVQMRFTY--PKMKSPSMQLTNM-DDDGAVILYRSGRTGMSKYLIGQMTEVAKEFYG.LDMTAYVLESQND
Q7Q9W6_ANOGA/1-170 MYGMLLESVQHFVQLEYGEFVWRQALLTTGCK-NTVFNTHQLYPDNLIPDLAAALSAITGKPFDEFMIFFGRCFVRFFSNFGYDELIKATGRYFCDFLHSVDN-IHLQMRFTY--RKMKSPSMQLTEV-DENGAVLVYRSTRTGFSKYLRGQLLEIAKQLYG.MDVSIKVLESQND
GCY33_CAEEL/1-170 MYGLVIEGVRFMIQENWGPQVLLQVQKLTSLS-EKSVSTHDQYSEHVVPQMFKAIHEITGTPYEQIGVLAGRFFVQFLIRNGYGDLMNVMGRRFSDFIKGLDN-IHEYFRFSY--PKLRAPSFYCKSE-SEDGLILHYRSRRTGYLSYVIGQLVELARVFYQ.LDIGIQVLKKKEK
Q9VFC5_DROME/18-187 MYGLLLENLSEYIKSVYGEEKWEDIRRQAGID-SPSFSVHQVYPENLLQKLAKKAQQVLGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDN-LHEYLKFSY--PRMRAPSFICENE-TKQGLTLHYRSKRRGFVYYTMGQIREVARYFYH.KEMHIELVREEIL
Q95NK5_HEMPU/1-172 MYGFVNHALELLVLREHGKDKWEEIKREAAVEIEGSFLVRIVYDDVLSYDLVGAAVKVLEISANDLLEAFGRMFFEFCVESGYDNILNVLGSTTRHFLQNLDA-LHDHLASIY--PGMRAPSFRCSTRESDGALVLHYYSERPGLEHIVIGLVRSVAKTLHG.SEVHVEIIKNKGE
O77106_MANSE/1-172 MYGFVNYALELLVMKTFDEETWETIKKKADVAMEGSFLVRQIYEDEITYNLITAAVEVLQIPADAILELFGKTFFEFCQDSGYDKILQVLGATPRDFLQNLDG-LHDHLGTLY--PGMRSPSFRCTERPEDGALVLHYYSDRPGLEHIVIGIVKTVASKLHN.TEVKVEILKTKEE
Q80WY4_RAT/1-172 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYGTILRVLGSNVREFLQNLDA-LHDHLATIY--PGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHG.TEIDMKVIQQRSE
Q8YUQ7_ANASP/1-172 MYGLVNKAIQDMISKHHGEDTWEAIKQKAGLEDIDFFVGMEAYSDDVTYHLVGAASEVLGKPAEELLIAFGEYWVTYTSEEGYGELLASAGDSLPEFMENLDN-LHARVGLSF--PQLRPPAFECQHT-SSKSMELHYQSTRCGLAPMVLGLLHGLGKRFQTkVEVTQTAFRETGE
GCY34_CAEEL/1-173 MFGFIHESIRQLVIRKYGEDVWLQVLERSGFENGKENIVNHYYSDTDTYVLVDSVSIVLKVTKDQIWEMYGGFLITYSMEIGWDELVRSMSPNLKGFLDNLDS-LHYFIDHVVYKANLRGPSFRCEEN-PDGTLMLHYFTGRPGLYHIVKGVVKEVAKLVFN.LDISLVVQGRTQR
GCY35_CAEEL/1-173 MFGWIHESFRQLVTRKYGKDIWEKIVHMSKFELGTESEIAHYYNDDETLRLVNSMANVIGIPIEEIWEAYGGFLIQFTMETGWDELLRAMAPDLEGFLDSLDS-LHYFIDHVVYKTKLRGPSFRCDVQ-ADGTLLLHYYSKRSGLYPIVKGVVREVARRIYD.TEVVMKVQERKQE
Q97E73_CLOAB/1-166 MKGTVVGTWVKTCKRLYGETVVENALEKVGFERKKIFSPFEDVEDSKVNNFIEDISKKVNEEKSIIWEKIGEDNVIAFHKDFPA---FFEHENLYSFFKSMFD-VHVVMTKKF--PGAKPPLILIKPI-SKREAIFTYRSKR-GMFDYLKGLIKGSANHFNE.-KIEIEEVEKTKE
Q899J9_CLOTE/20-185 MKGTIVATWMRTCRKLYNDDVVNKAMSSVGWDSNKIFKPTENVEDSDLKKVIEYIAKSEKLELGHLWRQIGKDNLVSFYNDFPA---FFQHENLYSFFNSLFD-IHVVMTKKF--PGAKPPLVTIEPI-SSKEAIFYYESKR-GMFDYLLGLIEGSIKYFKE.-DIEIEELERTNE
Q8RBX6_THETN/1-166 MKGTIVGTWIKTLRDLYGNDVVDESLKSVGWEPDRVITPLEDIDDDEVRRIFAKVSEKTGKNVNEIWREVGRQNIKTFSEWFPS---YFAGRRLVNFLMMMDE-VHLQLTKMI--KGATPPRLIAKPV-AKDAIEMEYVSKR-KMYDYFLGLIEGSSKFFKE.-EISVEEVERGEK
Q8EF49_SHEON/1-167 MKGIIFNVLEDMVVAQCGMSVWNELLEKHAPK-DRVYVSAKSYAESELFSIVQDVAQRLNMPIQDVVKAFGQFLFNGLASRHTD--VVDKFDDFTSLVMGIHDVIHLEVNKLY--HEPSLPHINGQLL-PNNQIALRYSSPR-RLCFCAEGLLFGAAQHFQQ.-KIQISHDTCMHT
Q8DAE2_VIBVU/1-168 MKGIIFTEFLELVEEKFGLTVLDDILDRAGDE--GVYTAVGSYDHRKLVSLIVHLSQVTGLSVEQLQEVFGEAVFDNLLASISNRSSLHQCHSTFQFIRHVEEYIHVEVKKLY--PDAKPPEFIFIEQ-DRMKMVFDYKSAR-CMGHVCLGLMRGCAKHFGE.-ELAIQMETLNPT
Q87NJ1_VIBPA/1-168 MKGIIFTEFMELVESKFGLEVLDQVLELSDDE--GVYTSVGSYDHRDLVKLIVNLSKVSDIPPEQLQEVFGESVFLNLLRSIPSHASLQQCDNTFQFVRHVESFIHVEVKKLY--PDANPPKFDFISE-TQSELVFDYHSAR-CMAHVCLGLLKGCAAHFGQ.-VIHIMHQNQTED