EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07694 alignment
(27 sequences with 108 aa)


Q9RYX3_DEIRA/36-123 DSRLQVPRFLLVSL.MCVPLMFFPAQV--------.-------APGVFVDLRAVPIAFLTLRLGWGWGLVGAVPLLVYRYLL--GGVGWPPAMVSAIGV.VLVAGLFH
Q9RVD9_DEIRA/32-118 TAIH-VPRLLLLAV.MAVVLMLYPAEV--------.-------APGVIIDMRAVPIAYLALRKGVWAGLLALIPLLLYRFHL--GGVGTWSAVFSAVGV.VLLGGLLH
Q8EGU1_SHEON/18-112 PKKHQRQYFLLWRLgIGVLIGGIGVAIMSTP----.----WMYEPGIIFDTRSVLLCVSGLFFGGLPTAIAVVITALYRLSI--GGVAMWVGVGVIITS.GLI-GVIW
Q929J8_LISIN/32-120 SINRKMVIGVWAGL.LGFALMIFGIPI--------.-------SNNVIVDLRHIPIIMVGFYGGPIPAIVSAVIITTSRFLISVNSAAVMAGVIMML-I.GIITALFS
Q8Y595_LISMO/32-120 STNKKIVIGIWAGL.LGFALMVFGIPI--------.-------SNNVIVDLRHIPIIMVGFYGGPIPAIVSAIIISASRFLL-SVNSAAIMAAVVMMLI.GIITAIFG
YHCK_BACSU/33-119 SISFQAVKGLACGL.LGVILMVFGFTY--------.--------QHSIIDLRNIPIMIAALYGGWVSTATALAMITAGRLLI--TMNTSALYSVIIICI.AAIPSLIV
Q81JN9_BACAN/33-119 SFWQKCVVGILTGI.LSVLLMYFGVHI--------.--------ENIMLDLRYLAVILAIIIGGPIASSITVTIILITRLFLTEYSLASELACYTIVLI.GI--GVTF
Q814L4_BACCR/33-121 SFGQKCVVGIFTGI.LGILLMYFGVRV--------.--------GTILLDLRYLAVILAVIIGGPIASTITIIMILVTRLLFMDYSLASQVAFYTIIAI.GIGSIFIS
Q8RBE9_THETN/38-124 TKKDLLITMLIFGL.IGIAGTYLGVPI--------.--------NDAIANSRVVGPMVAGLIGGPLVGLGAGLIAGVHRFFL--GGFTAISCGISTIIE.GFAGGLIR
Q7P590_FUSNV/39-127 TKKDIIALSFFFSL.LSISGTYIGLNF--------.--------NGAILNTRNVGVIAGGILGGPYVAIITGLVAGIHRAFVNLGRETAIPCAIATITG.GFLTAYVH
Q892V8_CLOTE/37-140 KEFNKLALIVFFSL.LSILGTYTGVNIDSMAPASFnKSTLINLNPHAIANTRPIGAITAGYLGGPLVGICVGLIAGLQRYYV--GGFTALACAVATIMG.GICGGLAR
Q8EDD8_SHEON/36-122 RLPHKIFIYLVFSS.FCIMATYFGEQT--------.--------SGAIANTRAMGAVLGGLLGGPVTGFLVGLTGGLHRYSM--GGFTDLACAISTTLE.GLSAGMIS
Q7NXG1_CHRVO/64-150 QLPHKLVCYLVFSM.FCIMGTYFGLHI--------.--------QDSIANTRAIGAVLGGMLGGPWVGLAVGFTGGLHRYSL--GGLTAGACMVSTMME.GLLGGLVH
YEHU_ECOLI/39-125 RLPHKFLCYIVFSI.FCIMGTWFGLHI--------.--------DDSIANTRAIGAVMGGLLGGPVVGGLVGLTGGLHRYSM--GGMTALSCMISTIVE.GLLGGLVH
Q87S85_VIBPA/36-122 RLSHRLICYVLFSG.FCILGTYFGLHI--------.--------NDAIANTRAIGAVMGGLFGGPVVGFAVGLTGGIHRYSL--GGFTDLACAISTTAE.GVIGGLLH
LYTS_BACSU/37-139 GYKGKAILISIFSL.FSIISNYTGIEIQRNMIVNN.DWVFTIDPSGSIANTRILGVEIGGLLGGPFVGAGIGILAGLHRFSL--GGSTALSCAVSSILA.GVLAGLIG
LYTS_BACCR/37-139 GYVDKLKLICIFSV.FTIVSNYTGIEIAGNTIMNE.NWLQGVSSSSTIANTRIMGVGISGLLGGPIVGIGVGSIAGIHRYML--GGTTALSCAISSILA.GVITGYIG
YPDA_ECOLI/41-129 SPKELLAVTAIFSL.FALFSTWSGVPV--------.--------EGSLVNVRIIAVMSGGILFGPWVGIITGVIAGIHRYLIDIGGVTAIPCFITSILA.GCISGWIN
Q8DZT0_STRA5/36-138 LKKHQYILLILFSL.FAIISNFTGVEIQSDLSIIP.QTLNHIADQSSVANTRVLTIGVSGLIGGPIVGIIVGLLSVFVRYLQ--GGLAPHIYVISSLLI.GLCSGLSG
LYTS_STAEP/37-139 KWRSKFQLIIIFGI.FSMISNFTGIEIENGHIVSS.DIYYHLSKDASMANTRVLTIGVSGLIGGPWVAIIVGIISGLCRLYI--GGADAYTYLISSIVI.AIISGYFG
LYTS_STAAM/37-139 TWKARWQLCIIFSL.FALMSNLTGIVIDHQHSLSG.SVYFRLDDDVSLANTRVLTIGVAGLVGGPFVGLFVGVISGIFRVYM--GGADAQVYLISSIFI.GIIAGYFG
LYTS_STRMU/34-137 SKREKLVLIIIFGI.FVIISNMTGIEITSDKSLVErPILTTISHSDSLANTRTLVITTASLVGGPLVGTVVGFIGGVHRFFQ--GNFSGAFYIVSSALV.GYISGRLG
LYTS_ENTFA/37-139 KMSSKVQLILIFGL.FAIISNFTGIEIAKNQIVPN.NLLTYLSSNASIANTRTLVIGVSGLVGGPIVGSAVGLIAGFHRVIQ--GGGHSFFYVPASLIV.GLIAGFLG
LYTS_OCEIH/37-139 TLKTVIYHSLIFGL.ISIIGAHVGVVMIGNELIMQ.AWIINVAENEVLIGFSIVVVMIAGLLGGPFLGLGTGMVAGLYIIFL--GGGGWVANSLINPLA.GLLTGWAG
Q97DD4_CLOAB/29-121 DKVRTIWGKVIVGV.FCGFAGILLLMYSKH-----.-----IKNTDTLIDLRAYAVMIASYTAGTLPTIISGIMIMLYRVFHFGVSVSSIVAAFRIL--.SYIIFFYI
Q99VM8_STAAN/30-116 MVFSKAYVTVLMTI.VSLLLSVYPIPY--------.-------REDYLIHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVV---FNNSIMYGVTLIVI.AAVTSAIG
Q8CTF5_STAEP/30-117 MIFSKEYVTVLMTF.VSLLLAAYPIPF--------.-------QNEYLVHLTFVPLLFLGRYTNMIYTLTAAFIVSLVDVFI---FGNSIIYGITLIVIaGIVSAVGP