EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07689 alignment
(16 sequences with 82 aa)


Q8YRW4_ANASP/169-250 RLFVAGHSANTERILKNLHELLERSLGYPYTMKVIDVLTNPEQAEIDQVSATPTLVKVWPLPIRRMVGDLDNAGKILQMLGA
Q8DLE2_SYNEL/186-267 RLYVRGETHAAEVALKNLHDLLSSALKVPYTLKVVDVTKQPDLAEKDQVQATPTLVRVYPQPVRRLVGQLDHRYRLQHLLSP
O27167_METTH/8-84 ALYVTGDSLS-ERALENLMDVIDD----RVELEVVNVLEKPWLARERGIIAIPTLERLNPGPERRVIGDLSDADALRRFLGI
Q8PXX4_METMA/35-116 RLYVAGMGPKSIQAINNIKHIFEEYAPGKYELEVIDIYQHPVFARDEQIVAAPTLIKELPPPLRKLIGSMSDTERVLMGMDL
Q8PXX5_METMA/28-109 RLYVAGQTKKSLTAFANLKKICEEHLGGRYRIEVIDLLENPQLAKGDQILAVPTLVRRLPPPIKKIIGDLSNTERVLVGLDL
KABL1_SYNY3/19-100 RLYVAGQTPKSVTAFINLKKICEEYLNGQYQIEIIDLTQQPELAIEDSILALPTLVRKLPEPIKKIIGDLSNTEKVLVGLQI
KAIB_ANASP/11-92 KLYVAGNTPNSVRALKTLKNILEQEFQGIYALKVIDVLKNPQLAEEDKILATPTLSKILPPPVRKIIGDLSDRERVLIGLDL
KABL2_SYNY3/9-90 RLYITGNSVRSQQAIANIYRICQEDLGDQYNVEIIDVLEQPQRAEEEKIMVTPTLIKQLPPPLQRIIGDMSNTEKVLLGLDI
SASA_SYNEL/20-101 LLFVANRPGDEEETAAIQAHIQQLPSNFSFELKVVPIGEQPYLLEEYKLVATPALIKVRPEPRQTLAGRKLLQKVDYWWPRW
SASA_ANASP/24-105 LLFVDGRPKSKQQVQRIRAYLKDLQAEYNFELQIIDVGQQPYLAEHFKLVATPALIKIHPEPRQILAGSNIITQLKNLWPRW
SASA_SYNY3/18-99 LLFIDDRPNSQDSVQEIGQCLTNLLDGHSHDLQILQISKHPHLVEHFRLVATPSLIKLQPEPRQVLAGSNIIQQLQKWWPRW
SASA_SYNP7/17-98 QLFVDTRPLSQHIVQRVKNILAAVEATVPISLQVINVADQPQLVEYYRLVVTPALVKIGPGSRQVLSGIDLTDQLANQLPQW
SASA_PROMA/15-96 LLVASRKHLSRGDLRSLIRFLESEDCGFEIKLQFSDPKEQPELLELHRLVAIPALIKLDPQPKQIFAGTSILEQLKNWLPRW
SASA_PROMP/10-91 ILVAARNHLSRGDLKLLLSYLESDDCEFEISLQISEPTEQPELLELHRLVAIPALIKVSPAPKQIFAGSNIFVQLQTWLPRW
SASA_PROMM/15-96 LLVAARHQLSRSDLRSMIQFLENEDCGFNVTLQMADPSEQPELLELHRLVATPALIKLSPTPKQVFAGSSIFQQLQNWITRW
SASA_SYNPX/15-96 LLVAARHHLSGPDLRSVVHYLERDDVGFQVTLQLADPSQQPELLELHRLVITPALIKLSPAPKQVFAGSNILQQLKGWVPRW