EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07640 alignment
(7 sequences with 36 aa)


Q7UWC5_RHOBA/27-62 LASDQPPLTRYGSFNQQPANAKTADWMHCPAWQIQS
Q7UWC0_RHOBA/14-49 MASNQPPLTRCGSMNRQPVSSGWKSRETYHLWSLPR
Q7UIX9_RHOBA/1-36 MASNQPPLTRCGSINQQPVSPGSHGTNPSRPPSEQN
Q7USN9_RHOBA/1-36 MASNQPPLKRCGSINQQPVRRPDCVLRNHRLEAFAT
Q7UV46_RHOBA/1-36 MASSQPPRTRCGSINQQPVSRFLRTFRIALNWATNR
Q7UKS6_RHOBA/1-36 MASDQPPLTRFGSFNQQSPRAQVPPQGSQYLPKDSP
Q7UVN7_RHOBA/1-36 MAPNQPPLTRCGSINQQSGRRQRPLRRPQHQPYQPP