EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07624 alignment
(15 sequences with 77 aa)


Q7UQA7_RHOBA/821-895 AKPQPYETPADLMKLLST--SDRVRETLTWKVTQFAMGRPLGARDVTEVERIHQAATGAGGRYADVVTAVVMSDLVQ
Q7UYT2_RHOBA/756-831 PSGESFEGFDAFRDCLLK-DPDQLAMSLITKWLTFATGREMGFSDRQEIESLTRQSAQRGHGLRTMLALVIASDIFR
Q7UIH1_RHOBA/765-841 PSGEEFTNFGDFKQKLLESRREQFTRSLIEKLLAYSTGRHMERADQFEIDDILVRVQADNNGLRTMVTDVLTSSLFR
Q7UQ19_RHOBA/635-710 FRKHRFENVIEFKDALLV-EKDRFTEALAGHLLSFALARPLSAADRVALDEITAKVAADEYKIHTLLRQVVLSEPFQ
Q7UJH8_RHOBA/855-931 FNQQELAGVEGLKRYLLEHRQDQFVRGMVHKLATYALGRPLTFSDHSSIDEITAEVRQRGDGLATMIEQLVTSDLFQ
Q7UJA2_RHOBA/950-1026 PDGGQGDGIEGLKDYIRRDREKDFVEHLCRKLLAFALGRSLQLSDESLIAEMQSNLEANEYRFQSMIETIVTSPAFR
Q7UGR4_RHOBA/564-639 PSGETFSGPEELKQLLLR-RSGEFKKHFVKKLYGFALGRSLNKFDNCVVDESLEALDNNEQRATVILETIVTSYPFR
Q7UKQ6_RHOBA/764-839 PGGAKFDGPEGLKQQLVK-RKDFIARTVTERLLTHALGRRMEPTDRAAVDAILMPLKGEDYPTAQLIESIVTSELFR
Q7UYH7_RHOBA/1250-1325 PDGTELQSVDELEAGIVA-RPDIFAQTVAEKLMTYALGRAVEPHDGPAIRRIVRGASQSNYTLASLINGIVLSEPFR
Q7UPC3_RHOBA/710-786 PDGTSFDGINGLRDLLTSQRSEQFVRCLAEKMLIYALGRGTEYYDKCAMDKITADVRAHDYKFAYLIAAIIQSDPFQ
Q7UVA3_RHOBA/763-838 PSGETFEGVDELRAVLMA-RQDAFLDEYIRRMLGFALARSLEEADACTIDSIRNQMLQNDLQTRELIHAIIQSTPFL
Q7UUL3_RHOBA/879-955 PGGRSFRGAMELSEMLASTETRRFADTTVRRLLSFAIGRELRPADRCFVEAILDDAEDEGFRLRDLVEGVINSPPFL
Q7UGA7_RHOBA/786-861 PNGNEFTGFEDFRGLLLQ-QSDRFRRALAEKVFVYAFGRPVGPEDDAPLTRVVTDMKAEGDTFRALIQSIVTSQAFV
Q7UH44_RHOBA/772-847 PIGQSFANFFELRDAVAQ-HKDAFVRGFTEALIAYGLGRPFGFTDQELANQISSQAKQHNHSIRQFIHALVQSPEFQ
Q7UPJ6_RHOBA/750-825 PEGSTFDSFVTFRNLIAK-KDERLAANVASHFVTYATGQTIQFADRDRIEKIVSNSRDNQFGFRSLLDEVIRSDLFL