EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07609 alignment
(4 sequences with 39 aa)


Q8CV42_OCEIH/43-81 NSVAVIVKHLSGNMVSRWSDFLTSDGEKSYRNRDQEFEN
Q7UW06_RHOBA/43-81 NSVAIILRHLGGNLRSRWTDFLTTDGEKPDRNRDAEFVD
Q81ED3_BACCR/43-81 NSIAIIIKHLHGNMRSRWTDFLTSDGEKTDRNRDGEFEG
Q81CU9_BACCR/44-82 NSIAIIIKHLSGNMHSRWTNFLTTDGEKEYRDRDGEFLD