EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07606 alignment
(4 sequences with 156 aa)


Q7UJY4_RHOBA/1-151 MSDLRSLQFENLDDAVLEAQSLLRTGYHPQGNWSLGQICRHLTLVQNPSVDGYPAWMSLFAFLRPAMRRFLLPKLRRP--DSPRGIRTSSMFVP--PEDIDDAEEVDTFARSVDRFRAHSGEYAPH-PAFGRMSRSEIEEIHTWHAAHHLRFLTPN
Q7UEB2_RHOBA/1-151 MEQLRELHFDDLNAAVREARSLLQSGYNRNGNWSLGQICRHLVLVQDPSVDGYPKWMSLFAFLRPVMRRILLPKVLSG--DSPRGIRTASMFVP--PADLDDAREVEAFSASVTRFYAHLGDYAPH-PAFGRLPRERIEQIHSAHAAHHLRFLAPR
Q7UH50_RHOBA/56-206 ATRRMDLRYPDLGAACTDIARLREGGYELVGTWSLAQILDHLNLSMQMTIDGAD--FTFPALMRPVMKWMFMPTMRKGKPSKLRG-KAPEQLQP--AMDLDEDACAKRFYSLAETLMDPSTPFVSHYPMLGRLTREQWLLMQQWHAAHHLSFVVPN
Q7UJR0_RHOBA/85-235 KISKRSLDFHSGDEVIAEIKRLQEGGYVQTKNWNLTQICEHLDLIMTGGMEGFGFRMP--RILRATVLKWIIGRILRQ--RKMSSAPTLDRLKPKSPDGPDDPSVIDHCIETIHRAKAFDGSMED-YPFVDNMTPDMWRQFMWLHAAHHLGFLVPK