EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07529 alignment
(14 sequences with 73 aa)


Q9LRX3_ARATH/541-607 GTAPVEVREKSQWDFVLEEMAWLANDFAQERLWKMTAAAQICHRVAL------TCQLRFEERNQHRKLKKIAS
Q7YZ94_DROME/508-579 PKLQEPSRPKAHWDYLLEEMVWLAADFAQERKWKKNAAKKCAKMVQKYFQDKATAAQRA-EKAQELQLKRVAS
EP400_MOUSE/799-870 PKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKLAAAKKLVRTVARHHEEKKLREERG-KKEEQSRLRRIAA
Q7X9V2_ARATH/36-107 EAPKEPRRPKTHWDHVLEEMAWLSKDFESERKWKLAQAKKVALRASKGMLDQASREERK-LKEEEQRLRKVAL
O59773_SCHPO/467-539 KRQNEMPRLKTHRDYVLDEMQWMSIDFSQERKWKIILAHRMANWVMDYHQASDKCTVCTPASLSKNKKPYMQE
SWR1_YEAST/340-411 SYFYKQQDLQIHTDHLINQGIHMSKLFRSSTKARIARAKKVSQMIEQHFKHVAGAEERK-AKEEERHKKSLAR
Q06337_YEAST/347-418 RFIDPWKQHNTHQNILLEEAKWMQADFKEGHKYKVAICTAMAQAIKDYWTYGEICCVKR-KTLLPGKENKLSD
Q22944_CAEEL/176-248 DRAILEKRRKVTNFHFLQSLTKHAREFKEFHKRNMLNHTKVRKSMQQYITNENKRIAREEMKNEKNRIQKLIQ
Q19106_CAEEL/272-344 QKMEQERKRRQKHTDLMQAIIQHGKEFKEYHRNNLLKMAKSRKAVMTYHQNNERERKKDEIRNEKLRMQKLMQ
Q7ZSY3_BRARE/478-550 QKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSITAKMQKLTKAVATYHANTEREQKKENERIEKERMRRLMA
BRM_DROME/501-573 QKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAEREQKKEQERIEKERMRRLMA
Q7Z1V5_TETTH/251-323 FKQEQEKRKKQKHREFLQQIFIHQNDFFEFHKKIKKQLKKRSNAARQYLEQLQIKQQMQKEKEAKERIQVLKS
SNF21_SCHPO/256-328 QRSDRERRLKQKQCDYLQTVCAHGREINVRTKNAQARAQKANRAVLAYHSHIEKEEQRRAERNAKQRLQALKE
Q7RYI6_NEUCR/344-416 QRDARENRERKKHVEFLQAVQNHKVEIQNVASIQRNKLQKMGRLMYAHHFNIEKEEQKRVERTAKQRLQALKA