EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07517 alignment
(70 sequences with 468 aa)


Q9PR25_UREPA/2-384 ..NLISKIS-.-PQNRILNR.ARLIAEEVLKKEEEYEHFSDQELINKSDDIIEYLANNN........PLDDKLVEALCIIREVIYRVHNKRAFKVQIIGAIIVYFGDFAEMMTGEGKTLTLVLVAYLNALYKKGVHMVTVNEYLVKVGAEFATPVLNFLNMS.....VGQIT.....ANM.NEY....EK.....RNNYNCDITYTTNSELGFDYLRDNMVTNYANKVQR...GLWFAIVDEGDSVLIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEQIKIEPENLTVATITY.QSLFRLYKKLAAVSGTAITEAEEFL
SECA_MYCGE/6-383 flKLISPKN-.----RILSK.ANRIASEVESYKNYYRNLTDQQLFEESNKLVDLVTKQN.......yTILDVCVAALALIREVVYRETGEFAYRVQIIGAFIVLSGDFAEMMTGEGKTLTIVLAAYVSALEKRGVHVVTVNEYLAQRDANNAMKILKRVGMS.....VGCNF.....ANL.SPQ....LK.....QAAFNCDVTYTTNSELGFDYLRDNMVHSYQDKKIR...ELHFAIVDEGDSVLIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEYVEIEPENVIVATITY.QSFFRLYNRLAAVSGTALTESEEFL
Q8EVL6_MYCPE/7-384 kfKKIKKKS-.----KILVK.AKLIAQQVENNREEYSALSIEDLRIRTDYLVDGLAKDK.......fTLEDIIVDALSIAREIIYREHGMLAYEVQMMGAYVVHTGDFAEMYTGEGKSLTLLLVSFVNALTKRGVHIVTVNEYLVERDALFAQKAFEKLGIT.....VGYNT.....SKL.SKA....TK.....KEMFARDITYTTNSELGFDYLKDNMVRDINEKVIR...ELFFVIVDEADSVLIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKERVTIEPENVVMATITY.QSFFRLYEKLSGVSGTAMTEAEEFL
Q82W86_NITEU/6-397 lkSIFGSRND.----RLIKQ.YLKIVRTINELEAAISPLSDEELRAKTSEFKQRVANGE........KLDQLLPEAFAVVREAGKRVLGMRHFDVQLIGGMVLHEGKIAEMRTGEGKTLMATLPTYLNALSGKGVHIVTVNDYLAKRDAEWMGQIYRFLGLT.....VGVVL.....SQM.PHE....EK.....QAAYAADITYGTNNEYGFDYLRDNMVGHSAERVQR...VLNFAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENVPIQKENQTLASITF.QNYFRMYEKLAGMTGTADTEAFEFQ
Q8XVJ6_RALSO/6-405 lkKIFGSRNE.----RLIKQ.YRRKVVQINALEPTFEALSDAELQAKTQAFRERFAKGE........TLDALLPEAFAVCREASKRVMKMRHFDVQLIGGMVLHDGKIAEMRTGEGKTLTATLAVYLNAIAGLGVHVVTVNDYLAQRDAEWMGKLYNWLGLS.....VGVNL.....TTM.AHD....EK.....QAAYAADITYGTNNEFGFDYLRDNMVYDDSQRVQR...PLNYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVQIQQENQTLATITF.QNYFRMYAKLAGMTGTADTEAYEFQ
Q9JTK7_NEIMA/6-397 akKIFGSRND.----RLLKQ.YRKSVARINALEEQMQALSDADLQAKTAEFKQRLADGQ........TLDGILPEAFAVCREASRRTLGMRHFDVQLIGGMVLHDGKIAEMRTGEGKTLVATLAVYLNALAGKGVHVVTVNDYLASRDAGIMEPLYNFLGLT.....VGVII.....SDM.QPF....DR.....QNAYAADITYGTNNEFGFDYLRDNMVTDQYDKVQR...ELNFAVVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVEIKRENQTLASITF.QNYFRLYTKLSGMTGTADTEAFEFQ
Q87AG8_XYLFT/6-398 ltRLFGSRNE.----RQLRQ.LNSIVAKINALEAELQKLSDTALQAKTTEFKQSIQDGK........SLDKLLPEAFAVCREASRRVLGMRHYDVQLIGGMVLHLGKIAEMRTGEGKTLVATLPVYLNALAGKGVHVVTVNDYLARRDAAHMGRLYNWLGLS.....VGVVY.....PGM.PHS....DK.....HAAYGADITYGTNNEFGFDYLRDNMALSKADRYQR...GLHYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVPVQRENQTLASITF.QNLFRIYKKLSGMTGTADTEAYEFQ
Q83F06_COXBU/6-407 ikKAFGTRNE.----RLLKG.YSKIVSRINALEPEIQALSDADLRAKTDEFKKRLVDGE........GLDALLPEAFAVVRETSVRTLGLRHFDVQIIGGLALHGGKIAEMRTGEGKTLGATMPAYLNALTGKGVHIVTVNDYLAKRDAEWMKPIYEFLGLT.....VGVNV.....PGM.EPV....EK.....QAAYAADITYGTNNEFGFDYLRDNMVFDLDQRVQR...PLHYAIIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGATIQLENQTLATITF.QNYFRLYEKLSGMTATADTEAFELQ
Q87WZ3_PSESM/6-402 lkKLFGSKNE.----REVKR.MLKTVQIVNAFEEQMVALSDEQLRAKTEEFKARIAKGE........TLDQLLPEAFAVAREAGKRVMGMRHFDVQLIGGMTLHEGQIAEMRTGEGKTLVGTLAVYLNALSGKGVHVVTVNDYLARRDANWMRPLYEFLGLT.....VGIVT.....PFQ.PPE....EK.....RAAYAADITYGTNNEYGFDYLRDNMAFSMDDKFQR...ELNFAVIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENLNIQAESQTLASTTF.QNYFRLYNKLSGMTGTADTEAFEFH
SECA_BUCAI/6-402 ltKIFSNHNN.----RILKK.FKKIVLSVNKLEKNFEKLSDKELQAQTELFRLRLRNGE........TLDDILPEAFALVREASKRVFSMRHFDVQILGGIALNKQCIAEMRTGEGKTLTSTLPAYLNALNGKGVHIVTMNDYLARRDAEKNTPLFEFLGLT.....VGLNL.....SEM.SFF....SK.....RKAYLSDITYGTNNEYGFDYLRDNMVFSPEERVQR...KLNYALVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENVSIKNENQTLASITF.QNYFRLYEKIAGMTGTAETESFEFN
Q8E9Q5_SHEON/6-402 ltKVFGSRND.----RTLKG.LQKVVNKINALEADYEKLTDEQLKAKTAEFRERLAAGA........SLDSIMAEAFATVREASKRVFEMRHFDVQLLGGMVLDSNRIAEMRTGEGKTLTATLPAYLNALTGKGVHVITVNDYLARRDAENNRPLFEFLGLT.....VGINV.....AGL.GQQ....DK.....KDAYNADITYGTNNEFGFDYLRDNMAFSPQERVQR...PLHYALIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVRIQNENQTLASITF.QNYFRLYEKLAGMTGTADTEAFEFQ
SECA_ECOLI/6-402 ltKVFGSRND.----RTLRR.MRKVVNIINAMEPEMEKLSDEELKGKTAEFRARLEKGE........VLENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRTGEGKTLTATLPAYLNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLT.....VGINL.....PGM.PAP....AK.....REAYAADITYGTNNEYGFDYLRDNMAFSPEERVQR...KLHYALVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVQIQNENQTLASITF.QNYFRLYEKLAGMTGTADTEAFEFS
O87123_VIBAL/6-402 ltKVIGSRND.----RTLRR.LRKIVKEINNYEPTFEALSDEELKAKTVEFRERLEKGE........TLDKLLPEAFATVREASKRVYGMRHFDVQLIGGMVLNAGQIAEMRTGEGKTLTATLPAYLNALAGKGVHIVTVNDYLAKRDAETNRPLFEFLGMT.....VGVNV.....PNM.PPQ....EK.....R-AYQADILYGTNNEFGFDYLRDNMAFRSEDRVQR...DRFFAVVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVKIQNENQTLASITF.QNYFRLYEKLSGMTGTADTEAFEFQ
SECA_HAEIN/4-400 ltRIFGSRNE.----RVLRK.LKKQVVKINKMEPAFEALSDDELKAKTQEFRDRLSGGE........TLQQILPEAFATVREASKRVLGMRHFDVQLIGGMVLTNRCIAEMRTGEGKTLTATLPCYLIALEGKGVHVVTVNDYLARRDAETNRPLFEFLGMS.....VGVNI.....PGL.SPE....EK.....RAAYAADITYATNSELGFDYLRDNLAHSKEERFQR...TLGYALVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVDVKSENQTVASISY.QNYFRLYERLAGMTGTADTEAFEFQ
Q8D301_WIGBR/6-402 fgKIFKNSND.----RALKV.INLIVKKINSLESTIEKLTDQQLSSKTIEFKNRISDGD........NLNNILPEAYAVVREASKRIFNMRHFDVQLMGGIVLNRRCIAEMSTGEGKTLTSVLPAYLHSLLGKGVHIVTVNDYLAKRDANNNKPLFEFLGIT.....VGINL.....PGL.NNI....EK.....RNAYLADITYGTNNEYGFDYLRDNMIFNENEKVQR...NLYFALVDEVDSILIDESRTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEKVNINNENQTLASITF.QNYFRLYEKLSGMTGTAYTEAAEFK
SECA_BUCBP/6-402 lkKLFSDRND.----RILQN.IQTVISKINSMEKFFEKLSDLELKRNTTRFCYRLNNGE........TLDQLLPESFATVREASKRVFGMRHFDVQLIGGIILHQRCIAEMRTGEGKTLTATLPAYLNALQRKGVHIVTMNDYLAKRDAEKNRLLFNFLGLT.....VGINI.....SGL.SSK....LK.....KQAYNADITYGTNNEYGFDYLRDNMVFCREDKVQR...ELNYALLDEVDSILIDESRTPLVISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLKIRSENQTLASITF.QNYFRLYKKLSGMTGTAITEAFEFR
SECA_RHOCA/8-392 grKLFGTPND.----RKVKR.TRPLVAKINALEPAFEKLSDAEIVAKTRELQARAQAGE........SLDALLVEAFANCREAARRALGLRAFDTQLMGGIFLHQGNIAEMKTGEGKTLVATFPAYLNALAGKGVHIVTVNDYLARRDSEWMGKVYRHLGLT.....CGVVY.....PFQ.PDD....EK.....RAAYGADITYATNNELGFDYLRDNMKSSVAEMYQR...DHFFAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKERVTIQPENVTLASVTF.QNYFRLYEKLAGMTGTAVTEAEEFG
SECA_CAUCR/5-392 akKLFGSSNE.----RKVKT.LATRVAKINAYEAEYAALSDEALKGKTAEFKARLEKGE........TLDDILNEAFAVVREASKRVLGMRHFDVQMVGGMVLHFSGISEMRTGEGKTLVATLPTYLNALEGKGVHVITVNDYLARRDADWMGQVYNFLGLS.....YGVIV.....NGL.SQG....ER.....QRAYRSDITYGTNNEFGFDYLRDNLVYSVDEMVQR...GHNFAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGADIQPENQTLASVTI.QNYFRLYKKLSGMTGTASTEAQEFD
Q8UA54_AGRT5/8-391 arKLFGSANE.----RRVRS.YKSKIAAINALEEATKALSDEALAAKTAEFRQQLADGK........TLDDLLIPAFAVAREASRRVLHMRPFDVQLTGAMILHGGAIAEMKTGEGKTLVATLAVYLNALAGKGVHVVTVNDYLAKRDAATMSKLYGFLGLT.....TGVIV.....HGL.DDD....QR.....REAYACDITYATNNELGFDYLRDNMKYDRAQMVQR...GHNYAIVDEVDSILVDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEKVQIQPENQTLSSVTF.QNYFRMYEKLAGMTGTASTEAEEFG
Q8FYD8_BRUSU/8-391 arKIFGSSND.----RRVKT.LRQRAEQITALEKNYENLTDEQLQAKTAEFRAALAEGK........SLDSLLPDAFATAREAAKRVLGMRPFDVQLIGGMVLHERGIAEMRTGEGKTLMATLPVYLNALEGKGVHVVTVNDYLATRDAETMGRLYNFLGLT.....VGVIK.....HGL.DDD....ER.....RAAYACDITYGTNNELGFDYLRDNMKYERAQMVQR...PHNYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEHVTIQPENQTLASITF.QNYFRMYNKLSGMTGTAATEAEEFG
Q89XV1_BRAJA/6-389 arKFFGSAND.----RRVKG.YQSRVNAINALEPELIKLSDEELKARTADFKKQLAEGK........TLDDLLVPAFATVREAAKRTLGQRHFDVQLIGGMVLHEGDIAEMKTGEGKTLVATLAVYLNALAGKGVHVVTVNDYLARRDSGWMGQIYGFLGMT.....TGVIV.....HGL.DDA....ER.....KTAYACDITYGTNNEYGFDYLRDNMKYRLEDMVQR...PHFFAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEHVQVQPENQTLASITF.QNYFRMYEKLAGMTGTAATEADELF
Q92H92_RICCN/5-389 lkKLFGTAND.----RTVKK.LFSEITKINSLEPAIQKLSDEELKNKTVEFKEKLKNGA........TLDDIVYEAFAVVREAAKRVCGMRHFDVQLIGGLILHRGMITEMRTGEGKTLVATLPAYLNALTGKGVHVVTVNDYLARRDSASMGKIYNFLGLS.....VGCIV.....GGM.PDE....VK.....RAAYNADITHATNNELGFDYLRDNMKYSLQERVLR...PFNFAIIDEVDSILIDEARTPLVISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENVKIQNENQTLASITF.QNYFRNYPKLSGMTGTAMTEAPELK
Q8F4S9_LEPIN/8-386 lrVVFGSKFE.----RDLKK.LIPIVRQINSLEESIKGMDDSTLSSQTKKFKERIVQGE........SLDSILPEAFATVREVSLRTMGMRHFDVQMMGGIALHGGNISEMKTGEGKTLTSTLAVYLNSLAGNGVHVVTVNDYLAKRDANWMKPIYDFLGIS.....VGVIQ.....HDM.DHE....QR.....KVAYAADITYGTNNEFGFDYLRDNMVSHKDHKVQR...SHFFAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENVTIAKESQTLASITF.QNYFRMYDKLAGMTGTADTEAEEFK
Q898W1_CLOTE/9-387 weKIFGTYS-.---QRELKR.VIPIVDKIDKLDQTMQKLTDEELKNKTNEFKERLSKGE........TLDDILVEAFAVAREAAWRVVKLKPYREQLIGGIILHQGRIAEMKTGEGKTLVATLPAYLNALKGEGVHIVTVNDYLAKRDKETMGAIYEFLGLT.....VGVIL.....HDL.EHN....ER.....QEAYNCDITYGTNSELGFDYLRDNMVVYKEERVQR...KLNFSIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVNVERESKTLATITY.QNFFRMYDKLSGMTGTAQTEEVEFR
Q97F94_CLOAB/4-382 leKIFGTYSD.----REVKR.IIPLVDKIDALDGSMQALSEDELKAKTAEFKQRYENGE........TLDDLLVEAFAVVREASSRILGLKHFREQIIGGIVLHQGRISEMKTGEGKTLVATLPSYLNAITGKGVHVVTVNDYLAKRDMEWMGQLYQYLGLT.....TGVIV.....HDL.DQK....QR.....QEAYAADITYGTNNEFGFDYLRDNMVIYKEERVQR...PLHFCIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVKVQKESKTLATITF.QNYFRMYEKLSGMTGTALTEEVEFR
Q8XIF0_CLOPE/4-382 fdKIFGSYSD.----REVKR.ITPIVDKIDSLGPEMEKLSDEELKQKTFEFKDRYAKGE........SLDDMLPEAFAVCREASTRVLGMKHYREQLIGGIVLHQGRIAEMKTGEGKTLVATLPVYLNAIAGKGVHVITVNDYLATRDKEWMGQLYEFLGLT.....TGVIV.....HGL.TND....QR.....REAYNADITYGTNNEFGFDYLRDNMVIYKEERVQR...PLHYCIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVKVQRESKTLATITF.QNYFRMYTKLAGMTGTALTEETEFR
Q8RCB4_THETN/8-386 veKIFGSYSE.----REVRR.LEPIAEKVLSYEDQMARLTDAELRAKTDEFKNRLKNGE........TLDDILPEAFAVVREAAWRTLKMKHFKVQIIGGIVLHQGRIAEMKTGEGKTLVATLPAYLNALEGKGVHIVTVNDYLAKRDRDWMGKIYEFLGLS.....VGVIL.....HDM.GPA....ER.....KKAYAADITYGTNNEFGFDYLRDNMVIYKEDMVQR...ELNYAIIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVKVERESKTLATITL.QNYFRMYKKLAGMTGTAQTEEQEFR
Q8GDT1_HELMO/5-380 lkKLLDDNA-.----KEVRK.LKKIVDQINSWEPEFTRLDDAALQYKTVEFRQRIENGE........SLDSLLPEAFATVREASKRVTGMRHFDVQLIGGMVLHQGRIAEMKTGEGKTLVATLPSYLNGLTGRGVHVVTVNDYLARRDSELMGRIHRFLGLK.....VGLIV.....HGL.DFA....ER.....RESYAADITYGTNNEFGFDYLRDNMVNQPHHMVQR...ELNFAIVDEVDSILVDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLKIQNESQTLATITL.QNYFRMYNKLSGMTGTARTEEDEFI
Q8RI93_FUSNN/6-407 lkKIFGTKND.----REIKA.LTKEVEKINALESEYEKLSDEDLKNKTNIFKERLKNGE........TLDDILVEAFATVREASKRVLGLRHYDVQLIGGMVLHQGKITEMKTGEGKTLVATCPVYLNALAGHGVHVITVNDYLAKRDRDQMSRLYGFLGLS.....SGVIL.....NGL.PTD....QR.....KKSYNSDITYGTNSEFGFDYLRDNMVSSLDQKVQR...ELNFCIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVKIASENQTLATITL.QNYFRMYKKLSGMTGTAETEATEFM
Q834A7_ENTFA/5-382 lkKMIENDK-.----KELRR.LEKIADKIDAHASAMEQLSDEQLREKTDEFKARYQKGE........TLDELLPEAFAVVREAAKRVLGLFPYRVQLMGGIVLHDGNIPEMRTGEGKTLTATMPVYLNALSGEGVHVVTVNEYLATRDSNEMGELYNFLGLS.....VGLNI.....NSK.SSD....EK.....REAYNCDITYSTNNELGFDYLRDNMVVYRSQMVQR...PLNYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVEIEDETKTMATITF.QNYFRMYKKLAGMTGTAKTEEEEFR
Q9CJ85_LACLA/5-395 irKLVENDK-.----KELKK.LNRMALQVESFADEMEHLTDEQLKAKTPELKERIAKGE........SLDDLLYEAFAVCREAARRVLGLYPFHVQIMGGIVLHNGDVPEMRTGEGKTLTATMPVYLNALSGKGVHVVTVNEYLATRDMTEMGELYSWLGLT.....VGLNL.....NSK.SPE....EK.....REAYNCDITYSTSAELGFDYLRDNMVTRAEDMVQK...PLNYALVDEVDSILVDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEAVPIQDESKTMASITI.QNYFRMYKKLSGMTGTAKTEEEEFR
Q8DNT8_STRR6/5-383 lkTIIENDKG.-----EIRR.LEKMADKVFKYEDQMAALTDDQLKAKTVEFKERYQNGE........SLDSLLYEAFAVVREGAKRVLGLFPYKVQVMGGIVLHHGDVPEMRTGEGKTLTATMPVYLNALSGKGVHVVTVNEYLSERDATEMGELYSWLGLS.....VGINL.....ATK.SPM....EK.....KEAYECDITYSTNSEIGFDYLRDNMVVRAENMVQR...PLNYALVDEVDSILIDEARTPLIVSGaXXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVPIQDETKTSASITY.QNLFRMYKKLSGMTGTGKTEEEEFR
Q88YL7_LACPL/5-382 lkRWVESDK-.----RTIRR.LDKIANKVEAYADEYGKLSDADLQAKTPEFRERYKEGE........SLDDLLPEAFATAREGAKRVLGLYPFHVQILGGIVLHQGDIAEMKTGEGKTLTATMPVYLNAISGKGVHVVTVNEYLSARDATEMGELYNWLGMS.....VGING.....AEK.SPE....EK.....RAAYNADITYSTNGEIGFDYLRDNMVVYREDMVQR...PLNFAIIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEHVEIQEETKTMANITY.QNLFRMYKKLSGMTGTAKTEQEEFR
SECA_BACSU/1-382 mlGILNKMF-.DPTKRTLNR.YEKIANDIDAIRGDYENLSDDALKHKTIEFKERLEKGA........TTDDLLVEAFAVVREASRRVTGMFPFKVQLMGGVALHDGNIAEMKTGEGKTLTSTLPVYLNALTGKGVHVVTVNEYLASRDAEQMGKIFEFLGLT.....VGLNL.....NSM.SKD....EK.....REAYAADITYSTNNELGFDYLRDNMVLYKEQMVQR...PLHFAVIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLEIQNESMTLATITF.QNYFRMYEKLAGMTGTAKTEEEEFR
Q815G7_BACCR/1-382 miGILKKVF-.DVNQRQIKR.MQKTVEQIDALESSIKPLTDEQLKGKTLEFKERLTKGE........TVDDLLPEAFAVVREAATRVLGMRPYGVQLMGGIALHEGNISEMKTGEGKTLTSTLPVYLNALTGKGVHVVTVNEYLAQRDASEMGQLHEFLGLT.....VGINL.....NSM.SRE....EK.....QEAYAADITYSTNNELGFDYLRDNMGLYKEECVQR...PLHFAIIDEVDSILVDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVEIQNESMTLATITF.QNYFRMYEKLSGMTGTAKTEEEEFR
Q8ENI7_OCEIH/1-383 maGILTKIFG.DGNQKQLKR.LEKQVDLIEQLEPEMEKLEDIDFKNKTEEFKTRYKNGE........SLNDLLIEVYALVREASKRVLGMRPFRTQLLGAIALHEGNISEMKTGEGKTLASTMPAYLNALTDEGVHIITVNDYLAERDAKDNGLLFDFLGIT.....VGFNH.....NGL.SKD....EK.....REAYLADITYGTNNEFGFDYLRDNMVLYKEQMVQR...PLNFAIIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLQIQNESMTLASITF.QNYFRMYNKLSGMTGTAKTEEEEFR
Q9K6W8_BACHD/1-383 mlGLLKKVVG.DPSQRQLKK.NQKIADQVEALSDEMKSLSDDGLRQKTEEFKKRYKNGE........SLDDLLPEAYAVVREAATRVLNMTPYPVQILGAIALHQGNIAEMKTGEGKTLVGTMPVYLNALAGKGVHVVTVNDYLARRDSEQMGAMFEFLGLT.....VGLNV.....PGL.SKE....EK.....KEAYQADITYGTNNEFGFDYLRDNMVLYKEQMVQR...SLNFALVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLQIQRESMTLASITF.QNYFRMYQKLAGMTGTAKTEEEEFR
SECA_LISMO/5-382 lkKIFESGK-.----KDVKY.LERKADEIIALADETAALSDDALREKTVEFKERVQKGE........TLDDLLVEAFAVAREGAKRALGLYPFKVQLMGGIVLHEGNIAEMKTGEGKTLTATLPVYLNALSGEGVHVVTVNEYLAHRDAEEMGVLYNFLGLS.....VGLNL.....NAL.SST....EK.....REAYACDITYSTNNELGFDYLRDNMVVYKEEMVQR...PLAFAVIDEVDSILVDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVTIQNESKTMATITF.QNYFRMYKKLAGMTGTAKTEEEEFR
SECA_STAAU/4-388 lsKILDGNN-.----KEIKQ.LGKLADKVIALEEKTAILTDEEIRNKTKQFQTELADIDnvk.kqndYLDKILPEAYALVREGSKRVFNMTPYKVQIMGGIAIHKGDIAEMRTGEGKTLTATMPTYLNALAGRGVHVITVNEYLSSVQSEEMAELYNFLGLT.....VGLNL.....NSK.TTE....EK.....REAYAQDITYSTNNELGFDYLRDNMVNYSEDRVMR...PLHFAIIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVQIQNESKTMASITF.QNYFRMYNKLAGMTGTAKTEEEEFR
Q9PNZ1_CAMJE/6-396 lkAVFGTKND.----REVKK.YFKRVAQINALEGNYQNLSDDELKAEFAKFKEQILSGE.......kNENDVLNDVFAIVRETGKRTLNMRHFDVQLIGGMVLHDGKIAEMKTGEGKTLVATLPVVLNAMSGKGVHVVTVNDYLAKRDAEQMSAIYNFLGFS.....VGVVL.....SSQnSDI....EH.....KQAYDCDITYGTNNEFGFDYLRDNMKFSKAEKVQR...EHNFVIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENVKIQEESQTLADITF.QNYFRMYNKLAGMTGTAQTEATEFS
SECA_HELPY/6-391 igKIIGTRND.----RWIKQ.YKKQVLTINALEPTYEKMSDDELQNAFEELKKRVRSTEkd..lqekTLLEVLPESFAITREASKRILKMCHFDVQLIGGMVLNDGKIAEMKTGEGKTLVATLAVALNALKGESVYVVTVNDYLAHRDSKEMEPLYHFLGYS.....VGTIT.....ASVrDDD....ER.....LEIYSKDIVYGTNNEFGFDYLRDNMKYSLEHKVQK...SHAFAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVSIKEESQTLADITF.QNYFRMFSKLAGMTGTAQTEATEFL
Q83N29_TROWT/6-385 leRILRAGEG.----RTLKR.LRNIAHTVNAIEDEYKGCTDGELRTFAFDLKVRHQNGE........SLDSILPEAFAMVREASSRTLGLRHFDVQIMGGAALHMGYIAEMFTGEGKTLVATLPAFLNSLSGNGVHIVTVNDYLAGYHSQQMGRVYKVLGLE.....TGVIL.....ADQ.DPS....TR.....AQQYRADITYGTNNEFGFDYLRDNMAWSCAERVQR...GHNFVILDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVEIKAENQTLATVTL.QNYFRLYKKISGMTGTAVTEASEFM
Q8G4G5_BIFLO/5-384 idKALRMGEG.----HQLKK.LENVAKAVNALEDEISALSDEDLKAQTPKFKQEIENGK........SLDEIMPEAFATVREVSKRTLGQRHFDVQLMGGAALHWGNIAEMKTGEGKTLVATLPTYLNALEGRGVHVVTVNDYLASYQSELMGRIYRFLGMN.....VGCII.....TEQ.KPP....ER.....RKQYNADITYGTNNEFGFDYLRDNMAWEKADLVQR...GHHYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVEVKAENQTFATITL.QNYFRMYDKLAGMTGTAETEAAEFM
SECA_STRGR/4-395 fnKLMRAGEG.----KILRK.LHRIADQVSSIEEDFVNLSDAELRALTDEYKERYADGE........SLDDLLPEAFATVREAAKRVLGQRHYDVQMMGGVALHLGYVAEMKTGEGKTLVGTLPAYLNALSGKGVHLITVNDYLAERDSELMGRVHKFLGLS.....VGCIV.....ANM.TPA....QR.....REQYGCDITYGTNNEFGFDYLRDNMAWSKDELVQR...GHNFAVVDEVDSILVDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVDIKDENQTLATITLqQNFFRLYDKLSGMTGTAMTEAAEFH
SECA1_MYCTU/2-383 lsKLLRLGEG.----RMVKR.LKKVADYVGTLSDDVEKLTDAELRAKTDEFKRRLADQKn.....peTLDDLLPEAFAVAREAAWRVLDQRPFDVQVMGAAALHLGNVAEMKTGEGKTLTCVLPAYLNALAGNGVHIVTVNDYLAKRDSEWMGRVHRFLGLQ.....VGVIL.....ATM.TPD....ER.....RVAYNADITYGTNNEFGFDYLRDNMAHSLDDLVQR...GHHYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEHVEIKAENQTLATITL.QNYFRLYDKLAGMTGTAQTEAAELH
Q8FRI7_COREF/4-382 lsKMLRVGEG.----RAVKR.LQKIADQVIALEDQYANLTDEELKAKTEEFKDRLAQGE........TLDDIFLDAFATAREASWRVLGQKHYKVQIMGGAALHFGNVAEMRTGEGKTLTCVLPAYLNALEGKGVHVVTVNDYLAKRDAEWMGRVHRWLGLS.....VGVIL.....SEL.RPA....ER.....KVAYDCDITYGTNNELGFDYLRDNMARSLNDLVQR...GHHYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEKVEIKNENQTLATVTL.QNYFRLYEKLSGMTGTAETEAAELH
SECA_SPIOL/85-467 lgNLLFNFKGgDPAESTKQQ.YASTVTLINQLEPQISSLTDSQLTDRTSLLRQRALSGE........SLDSILPEAFAVVREASKRVLGLRPFDVQLIGGMVLHKGEIAEMRTGEGKTLVAILPAYLNALTGKGVHVVTVNDYLARRDCEWVGQVARFLGLK.....VGLVQ.....QNM.TSE....VR.....RENYLCDITYVTNSELGFDFLRDNLATSVDELVLR...GFNFCVIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVPIQNETITLASISY.QNFFLQFPKLCGMTGTAATESAEFE
SECA_GUITH/1-379 mlNVLFG---.DPNERRINP.YKQIVNKINYLEAKLKKLTDSELQEQTERFIKLLSNNS........SNEELLPEIYATVREASLRVLGLRHFDVQLIGGLILNDGKIAEMKTGEGKTLVALLPTYLNALAGFGVHVVTVNDYLARRDSEWVGQVHKFLGLT.....VGLIQ.....EGM.SQF....ER.....RENYLKDVTYATNSELGFDYLRDNMAIDLEDIVQR...PFYFCVIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKESVPIQSETQTLASITY.QNFFLLYPKLSGMTGTAKTEETELD
SECA_PORPU/1-379 mfNLLFSSS-.--NQRRINS.YAATVKKINSLEQKIGNLSDEELFTKTSYFKDELKKGV........TLDYILPEAFSVVREAGCRVLGLRVFDVQIIGAIILHQGKIAEMKTGEGKTLVATLAGYLNALSGKGVHIVTVNDYLARRDSEWVGQIHKFLGLS.....VGLIQ.....QDL.SKA....ER.....KLAYQCDVTYVTNSELGFDYLKDNMVLSMSEIVQN...KFAFCIIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEQVPIQQENQTYASITY.QNFFLLYPKLSGMTGTAKTEESELD
SECA_SYNP7/1-397 mlNLLLG---.DPNVRKVKK.YKPLVTEINLLEEDIEPLSDKDLIAKTAEFRQKLDKVShspaaekeLLAELLPEAFAVMREASKRVLGLRHFDVQMIGGMILHDGQIAEMKTGEGKTLVATLPSYLNALSGKGAHVVTVNDYLARRDAEWMGQVHRFLGLS.....VGLIQ.....QGM.SPE....ER.....RRNYNCDITYATNSELGFDYLRDNMAAVIEEVVQR...PFNYAVIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXSKEGVEIQPETQTLASITY.QNFFLLYPKLSGMTGTAKTEELEFE
Q8YMS8_ANASP/1-379 mlKLLLG---.DPNARKLKK.YQPYITEINLLEEDIKVLSDEDLKGKTAEFKQRLAKGE........TLDDILPEAFAVVREAGRRVLGLRHFDVQMLGGVILHSGQIAEMKTGEGKTLVATLPSYLNALTGKGVHVITVNDYLARRDAEWMGQVHRFLGLS.....VGLIQ.....SSM.TPS....ER.....QKNYECDITYVTNSEVGFDYLRDNMATSMADVVQR...PFNYCVIDEVDSILVDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEHVDIQPETQTLATITY.QNLFLLYPKLGGMTGTAKTEEAEFE
SECA_SYNY3/1-386 mlKALFG---.DPNTRKLKK.FQPYVAEVNLYEEDIEKLSDDELKYKTVEFREALDKARsda.eteeILDEILPEAFAVVREAGKRVLGMRHFDVQLLGGIILHKGQIAEMKTGEGKTLVATLPSYLNGLTGKGVHVVTVNDYLARRDAEWMGQIHRFLGLT.....VGLVQ.....SGM.NPE....ER.....KKNYACDITYTTNSELGFDYLRDNMSTAMIEVVQR...PFNFCIIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKERVEIQKESQTLATITY.QNFFLLYPKLSGMTGTAKTEETELE
SECA_ANTSP/1-375 mfNFLFS---.----NKINQ.YQRIVKQINSLDSTYNKYSDQELKQQTNKLKDQIIATQ........DIDTILPKAFAITKEAIKRATGLLLFDVQLIGAIILNQGKIAEMKTGEGKTLVAMLTAYLNSLFNKGVHIVTVNEYLAKRDATLAKQIFEYLNIH.....IGIID.....QSM.HSQ....ER.....KKQYSCDITYLTNSELGFDYLRDNMAIQKEDLVQR...DFFFAIIDEIDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEKQKIQQENKTLASITY.QNLFLLYEKLSGMTGTAKTEEAELE
SECA_ODOSI/1-377 mlKNPFKKK-.----SIADK.YQTLIREINALESTVKTLTDGELRNKTNQLKQRYQDEQ........NLNNLIVESFALTREASYRTLGLRHFDVQLIGGLVLNGGKIAEMRTGEGKTLVATLPAYLNALTKKGVHIVTVNEYLASRDQTSMGQIYRFLGLE.....TGLIQ.....EKM.TTP....ER.....QRNYKADITYVTNNELGFDYLRDNLALNIRDVFLR...PFNYCIVDEVDSVLIDEALTPLIIAN.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENVAIRQTTEITASITY.QNFFLVYPKLSGMTGTAKTAEVEFD
SECA_PAVLU/1-377 mlKDILRKT-.--TQSDLYR.YENIVKKINDLERVMKPLTNEELRAKTLGFRKSIEDGQ........SIDNILPEAFGLVREASLRILGLRHYDVQLIGGCILHDSKIAEMKTGEGKTLVAILPAYLNALSGKSVHIVTVNEYLAKRDSLSVGRVLSFLGLS.....VGLIL.....ADM.NRE....ER.....QENYKCDVIYTTNSELGFDYLRDNLVGNPSEKVQN...GFEFAIIDEVDSVLIDEARTPLIISR.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVTVGSETMTMASITY.QNFFLFYKKLSGMTGTALTEAKEFK
SECA_CYACA/8-386 afNMVNTYID.---YLRLRK.YWKILNQIKKHREEIKQLTNNCLKIKTTEFKKRIKSGI........SLDQILPETFAVASEAAERVLGLNPYDVQMIGGIVLHEGKIAEMKTGEGKSLAASFPAYLNALTEKGVHIITVNDYLARRDYESIGKIFEFLGMK.....VGLIN.....QYT.PIS....KR.....KNNYLADITYVTNSEIGFDYLRDNMATQIKELTQR...PFHFCIIDEVDSILIDESRTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENLQIKEETKTLASITY.QNLFLLYLKISGMTGTAKTEENELI
Q9XI14_ARATH/68-451 lkRNVQDFT-.SMNYWVVRD.YYRLVESVNSLEPQIQSLSDEQLKAKTAEFRERLARGE........SLADMQAEAFAVVREAAKRTIGMRHFDVQIIGGGVLHDGSIAEMKTGEGKTLVSTLAAYLNALTGEGVHVVTVNDYLAQRDAEWMGRVHRFLGLS.....VGLIQ.....RGM.KAE....ER.....KFNYSCDITYTNNSELGFDYLRDNLTSNREQLVMRwpkPFHFAIVDEVDSVLIDEGRNPLLISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLEIQADSIVVAQITY.QSLFKLYPKLSGMTGTAKTEEKEFL
Q9RWU0_DEIRA/10-407 mfRVLNKVF-.DNNKRDVERiIQTVVKPVNALEEETMRV--ENLAEAFMDLRRRVQDGG.......eSLDSLIVPAFALIREAGRRSIGKRHYDTQLIGGAALHQGRIAEMRTGEGKTLVATLALAFNALEGKGCHLVTVNDYLARVGMEEMGLLYRTLGLT.....VGLAN.....REL.SPA....EK.....QAAYACDITYVTNSELGFDYLRDNMAQSKEALVLRadtPLHYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVKIENENQTLATITY.QNFFRLYDKFAGMTGTAKTEEKEFL
Q81UI7_BACAN/5-383 vkKLLGDSQK.----RKLKK.YEQLVQEINNLEEKLSDLSDEELRHKTITFKDMLRDGK........TVDDIKVEAFAVVREAAKRVLGLRHYDVQLIGGLVLLEGNIAEMPTGEGKTLVSSLPTYVRALEGKGVHVITVNDYLAKRDKELIGQVHEFLGLK.....VGLNI.....PQI.DPS....EK.....KLAYEADITYGIGTEFGFDYLRDNMAASKNEQVQR...PYHFAIIDEIDSVLIDEAKTPLIIAG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLEITEENQTQASITI.QNFFRMYPALSGMTGTAKTEEKEFN
Q98RA6_MYCPU/5-381 lkEIPFFKS-.----TEMKI.AEKTLQQINDLEPSVVNLTDEELQNKTDEFVRRIQEGE........TLEHIRPEVFAVSREATKRVLKKRPYDVQMLGGIILDLGSVAEMRTGEGKTITSIAPVYLNALEKKGVIVSTVNEYLAERDAAEMGEVFSFLKMT.....VGVNK.....PSM.SPE....EK.....KQIYQCDITYSIHSELGFDYLRDNMVTNINDKVQR...GLNYILLDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEFLEIESETKTLATITY.QNFFRMFKKLSGMTGTAKTEEQEFI
SECA_BORBU/6-406 leTTIGSKSK.----RDLKD.YLPTLRNINKLERWALLLADEDFSKETEKLKDELKSGN........SLENILERAFTLSREAARRRLKERPYDVQIIAGLALHKGKIIEMKTGEGKTLSSVQAAYLNSLTGDGVIIVTVNDYLAERDSNWMKPVFDLLGVS.....VGVVL.....SNM.DYE....LR.....KAQYAKDITYVTNNELGFDYLRDNMRYDLNEKSLR...KFNYCIIDEIDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVRVANENKTMATITF.QNLFRMFDKISGMTGTADTEAKEFH
SECA_TREPA/6-409 alRLIFGSQ-.--HERDLKN.LLPLLNAVNAQESWVLPLQESEFKQKTAEFKARAAAGE........ALDAFLPQAFALAREAARRVLGERPYDVQILGSLVLHHGKIVEMKTGEGKTLMSVAAAYLNSLSGRGVHIVTVNDYLAERDARWMRPVYDYLGVS.....VGVIL.....SSM.GSQ....ER.....RCAYACDITYGTNNELGFDYLRDNMQFLTEEKTQR...DFYFAIIDEIDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEHIRIAQRNRTMATITF.QNFFRMYKKLSGMTGTADTEALELN
SECA_OLILU/1-379 mfNFLENEK-.----YKLKE.YQPLVNQINLLETSVKNYTDIELKEQFDKLRKEYFLSQ.......nFSNDIIARSFSLTREAAFRTIGLRPFDQQLLGGLVLNSGKITEMKTGEGKTLVATLPAALNAISGRGVHIVTVNDYLAKRDSTWMGQIYDYLGLT.....VGLVQ.....SQM.ESQ....ER.....KDNYFQDITYITNSELGFDYLRDNQVKTFQEMVQR...KFNYCIIDEVDAILIDEARTPLVLSIpXXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKESIDITQTSRISSSITY.QNFFTLYPKLAGMTGTAKSAALELE
Q97P83_STRPN/1-382 mfRRLGQDF-.-----QLRK.VKKILKQINALKGKMSSLSDQELVAKTVEFRQRLSEGE........SLDDILVEAFAVVREADKRILGMFPYDVQVMGAIVMHYGNVAEMNTGEGKTLTATMPVYLNAFSGEGVMVVTPNEYLSKRDAEEMGQVYRFLGLT.....IGVPFtedpkKEM.KAE....EK.....KLIYASDIIYTTNSNLGFDYLNDNLASNEEGKFLR...PFNYVIIDEIDDILLDSAQTPLIIAG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEHVKLSPETRAMASITY.QSLFKMFNKISGMTGTGKVAEKEFI
Q8DYM7_STRA5/3-386 afNSLFSLDK.----KRLKK.LQRTLNTINSLKGQMATLSNEELQAKTTEFRKRLVNGE........TLDDICAEAFAVVREADERVLGLFPYDVQVIGGLVLHQGNTAEMKTGEGKTLTATMPLYLNALEGKGAMLLTNNSYLAIRDAEEMGKVYRFLGLS.....VGVGV.....SDN.EEE....DRdaatkRAVYSSDIVYSTSSALGFDYLIDNLASSKSQKYMP...KLHYAIVDEADAVLLDMAQTPLVISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXQKEHLNVTPESRAMASITY.QNLFRMFTKLAGMTGTGKTAEKEFI
Q8NUJ8_STAAW/1-386 mkHKLDVTI-.--NELRLKS.IRKIVKRINTWGDEVKSYSDDALKQKTIEFKERLASGV.......dTLDTLLPEAYAVAREASWRVLGMYPKEVQLIGAIVLHEGNIAEMQTGEGKTLTATMPLYLNALSGKGTYLITTNDYLAKRDFEEMQPLYEWLGLTaslgfVDIVD.....YEY.QKG....EK.....RNLYEHDIIYTTNGRLGFDYLIDNLADSAEGKFLP...QLNYGIIDEVDSIILDAAQTPLVISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGMEVSTDKSVMATITF.QNLFKLFESFSGMTATGKLGESEFF
Q8CMU9_STAEP/1-386 maKGVNQII-.--NNIRLRK.LRKILNQINALSEEFSNFSDEALQAKTKEFKVYLNDNK.......aSLNHILPQAYATVREASKRVLGMYPKDVQILGAIAMHQGNIAEMQTGEGKTLTATMPLYLNALTGKGAYLITTNDYLAKRDFLEMKPLYEWLGLS.....VSLGF.....VDIpEYEyaenEK.....YELYHHDIVYTTNGRLGFDYLIDNLADDIRAKFLP...KLNFAIIDEVDSIILDAAQTPLVISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXALENVEISQDMSVMATITF.QNLFKQFDEFSGMTGTGKLGEKEFF
Q83YC1_LISMO/1-376 mrQNYDDR--.----KIVKQ.YREIARQIVKKEGLYKNMDQAELCEQTNFWREK-FKTKpm..tdrdKIN-----IFALAREAASRIIGLDAVVVQLIGALVLGDGKVAEMKTGEGKTLMSLFVMFIEVMRGNRVHLVTANEYLARRDREEIGQVLEYLGVS.....VALNE.....SGL.DIA....QK.....KAIYTADVIYGTASEFGFDYLRDNMVRQKEDKVQS...GLDFVLIDEADSILIDEARTPLLISD.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVEVKEESRTLATITI.QNYFRMYKKISGMTGTAKTEEEEFR
SECA2_MYCLE/16-391 fwRLLGASTD.----KNLNY.SSAEVTAAAAYHKEAADLGDEQLRKACGLL--NLNDLA.......dSRD--VPQFLAIVREASERSTGLRPFDVQLLGALRMLAGDVIEMATGEGKTLAGAIAAAGYALAGRHVHVVTINDYLARRDAEWMGPLLEAIGLT.....VGWIT.....AES.TRE....DR.....KAAYGCDVTYASVNEIGFDVLRDQLVTDVDDLVSP...HPDVALIDEADSVLVDEALVPLVLAG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGIETTETGEVLDTITV.QALINRYATVCGMTGTALAAGEQLR
Q8FTJ6_COREF/19-392 fwKALGGKQG.----RNQKR.SLAIVDQAEAHTRDLEALDDAHLAARARTL---VGDGT........PQD--PAELLAVLGIAAHRTLGMRPFPVQSQAVLRLIEGDVVHMATGEGKTLVGAMAATGLGLQGKTVHSITINDYLAVRDAEWMRPLVEFFGLS.....VGAIS.....ETM.TPE....QR.....REAYRCDVVYGSVSEIGFDVLRDQLITRRADAVQR...RADVAIIDEADSVLVDEALVPLVLAG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLAVTEGGRILDTITL.QALVGRYPMVCGMTGTAVEATDQLR