EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07511 alignment
(5 sequences with 119 aa)


Q8GQ66_PSEAE/31-147 AAFAADVVVVTDSRHP-VKTMGGERLIELDRASGLEAELSADLPADPERAAAIVRQRLNQG-GTDLQRRIGTAYQGITDAWSLGVTTIPAVVVDQRYVVYGEPDVARAVSCIEQHRRRQ
Q8GPV0_PSEAE/28-144 LAQAAEILVVTDSRHP-VQATSDARLIELDQPARIEAELGAHLPADPSHGAALVQQRLNSG-GVELQQRLGAAYQGVVNAWSLGVTTIPAVIVDHRYVVYGEPDVAKAVALIEAHRRTQ
Q8PK93_XANAC/11-128 TAFAADVQVFTDRAHP-VAAAPGTTVVELDAPARLIAELGADLPADPRRAESLLRQRLASPKQRDLQSRIAQAYQRVADAYHLGVAKLPAVVVDGRYVVYGDANVGRAVARIAGHRNAR
Q83Z36_PSESX/28-144 F-SSAETSIVTDRNHP-VQTPAHVRLILLDESERLEAKLSEGLPANQQQAISIMQQRLKSSDAQRLQRDLALAQQDLVDAWSMGVTKVPAVVVDRKFVVYGETNATAAEYRIVQWRTAA
Q8Z1J0_SALTI/14-128 FSASAQIVVYTDQGHPPVGVTPAIRVVYLDASERWLQQQFGELSSDPEQAVRQAHSLLNSPDWKRRQKALIEHYRGMIEAWQLGLLKYPAVVFDNRDVVYGTVDISRAVAL----RRGE