EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07454 alignment
(9 sequences with 296 aa)


Q8R9I5_THETN/52-292 VHKKDMYLSGDNKLYEIVEVDEGEKIAYAKYIRTEKLPDV---------------------------DEEVSAAIAVSQNTGEKRIAIYSTHSDESYLP--SDGAASI-------NGHGGIYRVDTALQKALEDK-GVKVKVDWT-------LYLPHDAMAYTRSRAGAVKLLKEFK-PDLLLDVHRD.AVPLEEY---.IRKIAGKNAAGVRIVLGRNNPNLKANQNLAYRIKAIADKTYPHLIKDIF-----FGEGDFNQDLTPNALLLEFGTYPHTRQRAEVSAGFMADVLTK
Q8EPW1_OCEIH/94-372 LQPSDPRSLLGNELPGFSIYDSQILMASGDNHFTSFPIESNPPLEE---VLKDREA----VVEDDVDEELPPEEDIEQTTGDRDVVFLYTTHNRESFLP--HLPGVEDPNSAM--HAEINISKVSERLGQSLERK-GIGTYVDNTDFGQQLNEQGKKYHQSYEVSREAVETAFSGNKDIQYVFDLHRD.ALRRDKT---.TIEIEGESYAKLIFVVGTAHENYEENMKTATELNALIEEKYPGLSRGIYPKDGSNGNGVYNQDVSGNALLVEFGGVDNTMEELYRSADALAEVFSE
Q9KBM3_BACHD/90-369 IEMGDIRSLLGRELPGLALFDTRIIVAGEGTNLSNMPFESPPPMEV---LLEEREAVMESSDEEEADTE---STPDTERQTDSTRVFIHHTHSWESFLP--HLPGVENPNQAT--HNEMNIIKVGERLGDALEKH-GIQAAVDKTDMTALLHERNVRPSRAYEVSREIVQEAIKEHDDLSFIFDLHRD.SVRRDDT---.TVTINGKEYAQVLFVIGESHPDYEKNLELATKLHEKVEEKYPGLSRGVFGRDRSSGNGVYNQDLSDQSILIEFGGVDNHIDELNRSADAFAEVFAD
SP2P_BACSU/101-383 INLEDPRSFLGRELPGFAQFDTEILLAGQGTDYTNMPAESPPPSKV---MEEEREANLAEIEKQQTQSDNAQKDPPKQTTGDKKVVFIYHTHNTESYLP--LLKGETDPDMAR--HSKANVTLVGDMFGQALESQ-GIGATVNKTDIQSKLNKKGLNYARSYDESRPVVKDALASNKNLQYIIDIHRD.SRRKKDT---.TATIKGKSYARVAFVVGKKSKNFEENYKIASELHKLMEKKYPGLSTGVFSKGSPGDNGVYNQDLTDRALLLEFGGVDNNLEELQRAANAAADVFSE
O87702_BACME/80-361 IRAEDARSLFGSELPGFSIYDSNIIIAGEGTNFTNFPRESAPPLDE---TLKERNST---TKVQQPKENDGTNAPNNNTTGGKKVFYIYHTHSWESYLP--LLGLEGDPDANKAVDSKTNINMVANMLGKDLEAQ-GIGAEVDQTNIGQKLKEKGWNTNQSYAMSRTVIETALTENRDLTYFIDLHRD.SLRKDNT---.TIKINNKSYAKVVFVLGKANQNFEQNLKMAKALHEGLEKKYPGLSRGVIGKNKSSGNGVYNQDVSRNAILIEVGGVDNNFDELTNTTKALSDVISQ
Q892Q4_CLOTE/87-346 IKLEDPLTVLEKEISLINTSEI--------YKQKDYELEPFKLDEK-------YVLKEE--VKKEINKKIHNPNLKKKLDKSKPEIFIYHTHATESYKP--ENNFSL--------DMNKNICIVGDILTKELEDNYGISVIHDKT------LHDANAYTRSYERSGVTVDKYLKKYGDFKLIIDLHRD.GVKNTKLIEPfITSINGEKVAKIMFVLAKDNPHYSENLKVANSLLDISSRVFPGFCKPHR--CYDHVTRHFHQNKSNNSVLIEVGANSNNLQDAKNSAKYLARIIGE
Q892Q3_CLOTE/87-344 IKPEEPLTILGKEMAFIDTNEV--------YN-TDYKLHPFKLDEK-------YVLKEEKVVTKELNKKIHNPSLKKRLDKSKPEVFIYHTHATESYKP--EENFSL--------DLNKTVCAVGDILTKELEDNYGISVIHDKT------VHDANAYAMSYERSGVTVDKYLKKYGDFKLVIDLHRD.GLDNPKAV--.TTNINGENVAKIMFVLAQKNPHYKENLKVANSLSEISNKLFPGFYRSHH--YYGYGTKYFHQNKSNNSVLIEVGANSNNLQDAKNSAKYLARIIGE
Q97JJ8_CLOAB/86-350 LDINKPENVISKEVSFLGEALPK-------SIKSECPNESFTLDDK--DVVKSTSGSVQNEPLKNINENIYDPKLKKALDKSKPEILIYHSHTTEAYKPYPADSL----------NSTQNVCAVGDELVKELGEKYGIYAINDKT------VHNVVDYNKSYTRSGETLDKYLKQYGDFKMIIDMHRDsDVPKSKV---.TARINGEDVAKFMFVMTRKNPHFDKNMALVNGLVSICNKDFPGIFNGIY--YYDYGINYYNQQKSNNAFLLEVGSDINTIDEAKGTSKYLARIIAE
Q8XIS4_CLOPE/80-354 IKPLDPIELVMNEVPYFGAVNKIASIDKVNYVSAEKVS-SFDLNKDSIDIVSEEESKESAELEASKNSEVYDPSLKKELDQSKPEVLIYHTHNSEGYTE--ERTSN---------NEEHNVVGVGTLVAKELEENYGISVIHDKT-------NHSASYEQSYNKSRETVKKYINEYDDFKMVIDIHRD.SVGEHNKKNL.TANINGESLAKIMFVTTKNSQYFNDAESLAYRFINKANELFPDILRRQETFKYDRGKNAFNQQYNKNSMLIEVGAEVNTSKEAQATAKYIARLIAE