EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07444 alignment
(6 sequences with 84 aa)


Q8MA14_CHAGL/2-85 IHMEIGPSTFVGICLIIMGIILYLLKTQKPEVSKEYDLLFSSIGLLSGGILIFQGWRLDPILLLCQILCSGTAIFFVLESLYLR
YCF66_MARPO/2-85 NHMELGPSTILGVGLIIIGLFLYALKLREPYVSRDYDFFFSCIGLLCGGILFFQGWRLDPILLLSQILLSGTTIFFIAESLYLR
YCF66_MESVI/2-85 INIEFGPSTILGIAVVCGGILLYITRTIKPEISRDHDIFFSSVALLIGGILIFQGWRLDPILLFGQMLSTGTALCFIIESLKLR
Q9F1R5_9CHRO/14-97 VNVGLGPAGLLGIGLAVAGALLYFLRSIQPELARDHDIFFAAVALLCGGILFFQGWRLDPILLFGQFLLTGTAAFFAYESIRLR
Q8YYA9_ANASP/15-98 VNFGTNSASILGIFLAVAGAALYFLRTVRPELSRDQDIFFAAVGLLCGFILIFQGWRLDPILQFGQLLLVGTTVFFAVESIRLR
YCF66_ODOSI/2-85 INFSFGPNIFLGFILGFGILLLYLLRFVKPEVARDEDLFFVTLGLLYSSILVVHGWRLDPILLFSQVLIIASVLGAGWENIRLR