EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07436 alignment
(2 sequences with 87 aa)


O93126_9GEMI/1-87 MVCLPDWLFLLFIFSILLQSGTNFYGTFQSGSISRQLSSLSSSIDQLFLKVQQVVYTRYPSRDRGSDPRRRRGLSSIPEGSEEATEA
Q68539_9GEMI/2-88 MVCLPDWVFLLFIASILLQACTNFYGTFHSGSISKKLSSLVSRFDELFFQIQQVVYTRYPSRSRIVNPRRRGSLSGIPEGGEETVEA