EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07404 alignment
(3 sequences with 387 aa)


TEBB_OXYNO/1-372 MSKGASAPQQQSAFKQLYTELFNNEGDFSKVSSNLKKPLKCYVKESYPHFLVTDGYFFVAPYFTKEAVNEFHAKFPNVNIVDLTDKVIVINNWSLELRRVNSAEVFTSYANLEARLIVHSFKPNLQERLNPTRYPVNLFRDDEFKTTIQHFRHTALQAAINKTVKGDNLVDISKV--ADAAGKKGKVDAGIVKASASKGDEFSDFSFKEGNTATLKIADIFVQEKGKDALNKAADHTDGA------KVKGGAKGKGKAAAKAA-KGKKLSAKKGDS-SAADVRKSVDKIVKYTPSK-GSRKDTPQKSQ-APAAGKSSAKK---GGKKAVPSAPSPSGKKSALTTDKMTMAQFVKYLDWHEKKKGGKVSSGGKVLGKRSAGKASATSG
TEBB_STYMY/1-381 MSKGQ-A-QQQSAFKQLFTEFFNLGGDFSKVSKDLKKPLKTYVKESYPHFLVTDGYFFVQPHFTKEAVAEFHQKFPNVNIVDLHDKVIVINSWSLELRRVNSAEVFTSYANLEARLVVHSFKPNLQERLNPTRYPVNLFRDDEFKTIIQHFRHQALQQSIAKNTKQESLPDISKLSGADAAGKKTKVDGGIVKTGASKGDEFADFSFKEGSTAVLKIQDIFVQEKGKDALKRIQD-QQVESVQVQPKVRGGAKGKKKAATKSA--TKKTVAAKK-TAESADVRKSVDKIVKYTPNKPSSRKETPQKSQSAPAAGKSSAKRTTTGSKTKIPANPSPSGKKSTKTTDQMTMAQFKKYLDWHEKKKGGKTSSGGKVLGKRSAGKASATSG
Q9GNS5_OXYTR/1-375 MSKSQQV-QQQSAFKQLYTELFNNGGDFGKVSNNLKKPLKCYVKESYPHFLVTDGYFFVTPYFTKEAVTEFHSKFPNVNIVDLHDKVIVINNWSLELRRVNSAEVFTSYANLEARLIVHSFKPNLQERLNPTRYPVNLYRDDEFKTTIQHFRHQALQQSLAKNLKQENIPDIAKVTGGD---KKAKVDAGIVRASTSKGDEFSDFSFKEGNTATIRIQDIFVQEKGKDALSKLGGEGDV-------KVKGGARGKAKAASKSAARGKKGSAKKADVGASADVRKSVDKIVKYTPNKPSSRKETPQKSQSVPA-GKSSAKKTTTGSKKTLPANPSPSGKKSTKTTDQMTMAQFKRYLEWHEKKNVGKTSSGGKVLGKRSAGKASATSG